Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847895
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DUSP27
Proper citation: Atlas Antibodies Cat# HPA012608, RRID:AB_1847895 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844465
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ACADL
Proper citation: Atlas Antibodies Cat# HPA011990, RRID:AB_1844465 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685650
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RPRD1B
Proper citation: Atlas Antibodies Cat# HPA066290, RRID:AB_2685650 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2259078
Comments: manufacturer recommendations: Immunohistochemistry; Immunoprecipitation; Western Blot; Immunohistochemistry Frozen, Immunohistochemistry Paraffin, Immunoprecipitation, Western Blot
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: polyclonal
Target(s): Livin / BIRC7 / KIAP
Proper citation: IMGENEX Cat# IMG-5732, RRID:AB_2259078 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679971
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): WDR5
Proper citation: Atlas Antibodies Cat# HPA047182, RRID:AB_2679971 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2247872
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GPRASP1
Proper citation: Atlas Antibodies Cat# HPA000161, RRID:AB_2247872 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854125
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): MRPS23 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA023453, RRID:AB_1854125 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080003
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC27A3
Proper citation: Atlas Antibodies Cat# HPA006935, RRID:AB_1080003 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848316
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human EXOC7
Proper citation: Sigma-Aldrich Cat# HPA022840, RRID:AB_1848316 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847632
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human DGCR2
Proper citation: Sigma-Aldrich Cat# HPA000873, RRID:AB_1847632 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079066
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human HLX1
Proper citation: Sigma-Aldrich Cat# HPA005968, RRID:AB_1079066 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10891442
Comments: Applications: W, IP
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: monoclonal
Target(s): Phospho-FAK (Tyr397) (D20B1) Rabbit mAb
Proper citation: Cell Signaling Technology Cat# 8556, RRID:AB_10891442 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10720162
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40373 for K562,MCF-7,HEK293T; status is awaiting lab characterization,pending dcc review
Host Organism: rabbit
Clonality: polyclonal
Target(s): FOXM1
Proper citation: GeneTex Cat# GTX102170, RRID:AB_10720162 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2728728
Comments: for use in western blotting (WB) & Chromatin immunoprecipitation (ChIP). original provider is Merck
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: polyclonal
Target(s): Histone H3.3, K27M mutant
Proper citation: Millipore Cat# ABE419, RRID:AB_2728728 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682705
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCDC28A
Proper citation: Atlas Antibodies Cat# HPA055125, RRID:AB_2682705 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671507
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQRE; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): HRH4
Proper citation: Atlas Antibodies Cat# HPA035009, RRID:AB_10671507 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962977
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LMNTD1
Proper citation: Atlas Antibodies Cat# HPA045911, RRID:AB_10962977 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682928
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SERPINE3
Proper citation: Atlas Antibodies Cat# HPA055804, RRID:AB_2682928 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682492
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ICE1
Proper citation: Atlas Antibodies Cat# HPA054452, RRID:AB_2682492 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078126
Comments: Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): ALDH9A1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA010873, RRID:AB_1078126 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.