Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 120 showing 2381 ~ 2400 out of 141,649 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection
  • RRID:AB_2066074

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_2066074

Comments: validation status unknown, seller recommendations provided in 2012: Immunocytochemistry; Immunofluorescence; Western Blot; Immunohistochemistry - fixed; Immunohistochemistry; Immunoprecipitation; ICC, ICC/IF, IHC-P, IP, WB
Host Organism: mouse
Clonality: monoclonal
Target(s): BubR1 antibody [8G1]

Proper citation: Abcam Cat# ab4637, RRID:AB_2066074 Copy   


  • RRID:AB_677310

    This resource has 1+ mentions.

Discontinued

http://antibodyregistry.org/AB_677310

Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; Western Blot; Immunofluorescence; WB, IP, IF, ELISA
Host Organism: goat
Clonality: polyclonal
Target(s): Nup96 (C-20)

Proper citation: Santa Cruz Biotechnology Cat# sc-27400, RRID:AB_677310 Copy   


  • RRID:AB_2211262

    This resource has 1+ mentions.

Discontinued

http://antibodyregistry.org/AB_2211262

Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: WB, IP, IF, IHC(P), ELISA; Immunofluorescence; ELISA; Immunohistochemistry; Immunoprecipitation; Western Blot; Immunocytochemistry
Host Organism: goat
Clonality: polyclonal
Target(s): gamma Tubulin (C-20)

Proper citation: Santa Cruz Biotechnology Cat# sc-7396, RRID:AB_2211262 Copy   


  • RRID:AB_396562

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_396562

Comments: Applications: Western blot, Immunohistochemistry-frozen
Host Organism: mouse
Clonality: monoclonal
Target(s): TIE2 (CD202b)

Proper citation: BD Biosciences Cat# 557039, RRID:AB_396562 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1845406

Comments: Vendor recommendations: Immunohistochemistry; Immunofluorescence; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): BNIP3L antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA015652, RRID:AB_1845406 Copy   


http://antibodyregistry.org/AB_2298971

Comments: Applications: W, IP, IHC-P, IF-IC. Consolidation on 11/2018: AB_10363754, AB_2156885, AB_2298971.
Host Organism: rabbit
Clonality: monoclonal
Target(s): Asymmetric-Methyl-PABP1 (Arg455/Arg460) (C60A10) Rabbit mAb

Proper citation: Cell Signaling Technology Cat# 3505, RRID:AB_2298971 Copy   


http://antibodyregistry.org/AB_11043137

Comments: Applications: Flow, ICC/IF
Host Organism: rat
Clonality: monoclonal
Target(s): CD324 (E-Cadherin)

Proper citation: Thermo Fisher Scientific Cat# 50-3249-80, RRID:AB_11043137 Copy   


  • RRID:AB_11042790

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_11042790

Comments: vendor suggested use: IgG; IgG ELISA (1:20000), IHC-P (2 µg/ml), WB (1:500); Western Blot; Immunohistochemistry - fixed; Immunohistochemistry; ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): ATF4

Proper citation: LSBio (LifeSpan) Cat# LS-B6361-50, RRID:AB_11042790 Copy   


http://antibodyregistry.org/AB_1272006

Comments: Applications: Flow (Assay-Dependent), Ctrl (Assay-Dependent)
Host Organism: mouse
Clonality: isotype control
Target(s): Mouse IgG2a kappa

Proper citation: Thermo Fisher Scientific Cat# 48-4724-82, RRID:AB_1272006 Copy   


  • RRID:AB_11001827

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_11001827

Comments: Applications: ICC
Validation status: IF or IB (Pass), IB in brain (ND), IHC in brain (ND), KO (ND)
This clone is associated with these products: purified (Antibodies Incorporated, Cat# 75-280, RRID:AB_11001827), supernatant (Antibodies Incorporated, Cat# 73-280, RRID:AB_11030251), hybridoma (UC Davis/NIH NeuroMab Facility, Cat# N312/10, RRID:AB_2877552)
Host Organism: mouse
Clonality: monoclonal
Target(s): NSD1

Proper citation: Antibodies Incorporated Cat# 75-280, RRID:AB_11001827 Copy   


  • RRID:AB_304066

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_304066

Comments: validation status unknown, seller recommendations provided in 2012: ELISA, IHC-Fr, IHC-P, sELISA, WB; ELISA; Immunohistochemistry - frozen; Immunohistochemistry - fixed; Western Blot; Immunohistochemistry
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality: monoclonal
Target(s): Aggrecan ARGxx antibody [BC-3]

Proper citation: Abcam Cat# ab3773, RRID:AB_304066 Copy   


  • RRID:AB_11154032

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_11154032

Comments: Applications: Flow cytometry
Host Organism: mouse
Clonality: monoclonal
Target(s): CD28

Proper citation: BD Biosciences Cat# 561368, RRID:AB_11154032 Copy   


  • RRID:AB_11153500

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_11153500

Comments: Applications: Flow cytometry
Host Organism: armenian hamster
Clonality: monoclonal
Target(s): CD183 (CXCR3)

Proper citation: BD Biosciences Cat# 562266, RRID:AB_11153500 Copy   


http://antibodyregistry.org/AB_3095412

Comments: Applications: Flow Cyt (Intra), WB, IHC-P, ICC/IF, IP
Host Organism: Rabbit
Clonality: recombinant monoclonal
Target(s): TOMM40

Proper citation: Abcam Cat# ab185543, RRID:AB_3095412 Copy   


  • RRID:AB_10597100

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_10597100

Comments: Originating manufacturer of this product.
Applications: IHC, IF, ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): INS

Proper citation: Proteintech Cat# 15848-1-AP, RRID:AB_10597100 Copy   


  • RRID:AB_10839702

    This resource has 1+ mentions.

Discontinued

http://antibodyregistry.org/AB_10839702

Comments: Discontinued: 11-2018; Target Distribution B cells, dendritic cells, endothelial cells, Langerhans cells, monocytes, T cells; target type CD markers; tested applications MACS Flow Cytometry; quantity:
Info: This product is discontinued and reformatted to a higher concentration for optimized use in multicolor flow cytometry panels. The replacement product cat # is 130-113-572. (RRID:AB_2733843).
Host Organism: mouse
Clonality: monoclonal
Target(s): CD86

Proper citation: Miltenyi Biotec Cat# 130-094-877, RRID:AB_10839702 Copy   


  • RRID:AB_10599302

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10599302

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP; Manufacturer approved use: ICC-IF, IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): OTUD3

Proper citation: Atlas Antibodies Cat# HPA028543, RRID:AB_10599302 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1227812

Comments: Applications: FC
Host Organism: mouse
Clonality: monoclonal
Target(s): TRA-1-60-R

Proper citation: BioLegend Cat# 330606, RRID:AB_1227812 Copy   


http://antibodyregistry.org/AB_2107855

Comments: validation status unknown check with seller; recommendations: western blot, ELISA, immunoprecipitation, immunocytochemistry
Host Organism: mouse
Clonality: monoclonal
Target(s): Gab1

Proper citation: Santa Cruz Biotechnology Cat# sc-133191, RRID:AB_2107855 Copy   


http://antibodyregistry.org/AB_1227504

Comments: Applications: FC
Host Organism: mouse
Clonality: monoclonal
Target(s): CD107a

Proper citation: BioLegend Cat# 328610, RRID:AB_1227504 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X