Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-PLAA antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA020994, RRID:AB_1855444 PLAA antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Other; Western Blot; Immunohistochemistry polyclonal rabbit AB_1855444 Sigma-Aldrich HPA020994 2025-08-19 11:32:16 0
Anti-C9orf46 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA008214, RRID:AB_1078363 C9orf46 human Vendor recommendations: unknown rabbit AB_1078363 Sigma-Aldrich HPA008214 2025-08-19 11:28:54 0
Anti-TRIM8 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA023561, RRID:AB_10601861 TRIM8 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601861 Atlas Antibodies HPA023561 2025-08-19 11:29:03 0
Anti-RABL3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035151, RRID:AB_10601154 RABL3 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601154 Atlas Antibodies HPA035151 2025-08-19 11:29:03 0
Anti-ENKUR
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA037594, RRID:AB_2675568 ENKUR human unknown rabbit AB_2675568 Sigma-Aldrich HPA037594 2025-08-19 11:29:04 0
Anti-S1PR5 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA029683, RRID:AB_10603237 S1PR5 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSFSGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEP; Manufacturer approved use: IHC, WB polyclonal rabbit AB_10603237 Atlas Antibodies HPA029683 2025-08-19 11:29:13 0
ZNF783-human
 
Resource Report
Resource Website
Rating or validation data
CDI Cat# R1257.1.2A8, RRID:AB_2615917 ZNF783 Homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot 20141229.LRH.LAS for not specified; status is not pursued unknown mouse AB_2615917 CDI R1257.1.2A8 (also ENCAB334XGK) 2025-08-19 11:29:12 0
Anti-COL13A1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA050392, RRID:AB_2681110 COL13A1 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681110 Atlas Antibodies HPA050392 2025-08-19 11:29:13 0
Anti-RASGRP1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA046216, RRID:AB_2679590 RASGRP1 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGD; Manufacturer approved use: ICC-IF polyclonal rabbit AB_2679590 Atlas Antibodies HPA046216 2025-08-19 11:29:04 0
Anti-CENPP
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA021787, RRID:AB_1846524 CENPP human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1846524 Atlas Antibodies HPA021787 2025-08-19 11:29:03 0
Anti-SORBS1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA027559, RRID:AB_10600812 SORBS1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10600812 Atlas Antibodies HPA027559 2025-08-19 11:29:03 0
hda-1-celegans
 
Resource Report
Resource Website
Rating or validation data
SDIX Cat# 2217.00.02, RRID:AB_2616446 hda-1 caenorhabditis elegans ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization unknown rabbit AB_2616446 SDIX 2217.00.02 (also ENCAB642JYJ) 2025-08-19 11:29:00 0
Anti-FAM167B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA062074, RRID:AB_2684677 FAM167B human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684677 Atlas Antibodies HPA062074 2025-08-19 11:29:04 0
Anti-RIF1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036888, RRID:AB_2675362 RIF1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2675362 Atlas Antibodies HPA036888 2025-08-19 11:29:03 0
Anti-HGFAC
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA059076, RRID:AB_2683898 HGFAC human unknown rabbit AB_2683898 Sigma-Aldrich HPA059076 2025-08-19 11:29:14 0
Anti-TM2D2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA047152, RRID:AB_2679957 TM2D2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679957 Atlas Antibodies HPA047152 2025-08-19 11:29:04 0
H3K27me2-dmelanogaster
 
Resource Report
Resource Website
Rating or validation data
Thomas Jenuwein Cat# non-commercial H3K27me2 modENCODE antibody 1, RRID:AB_2616511 H3K27me2 drosophila melanogaster ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization unknown rabbit AB_2616511 Thomas Jenuwein non-commercial H3K27me2 modENCODE antibody 1 (also ENCAB750SJL) 2025-08-19 11:29:12 0
Anti-PRM1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA055150, RRID:AB_2682718 PRM1 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682718 Atlas Antibodies HPA055150 2025-08-19 11:29:04 0
Anti-FBLN5 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA000868, RRID:AB_1078619 FBLN5 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Western Blot; Other; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1078619 Sigma-Aldrich HPA000868 2025-08-19 11:29:27 0
Anti-KDM5A antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA006201, RRID:AB_1079160 KDM5A antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_1079160 Sigma-Aldrich HPA006201 2025-08-19 11:29:44 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.