Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673127
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): BOD1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA036293, RRID:AB_10673127 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2532109
Comments: IHC-FoFr, Flow Cyt, IHC-Fr, IHC-P, WB, ICC/IF
Host Organism: rabbit
Clonality: monoclonal
Target(s): NeuN
Proper citation: Abcam Cat# ab177487, RRID:AB_2532109 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853778
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MAP4K1
Proper citation: Atlas Antibodies Cat# HPA007419, RRID:AB_1853778 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845480
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KLHL28
Proper citation: Atlas Antibodies Cat# HPA000988, RRID:AB_1845480 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603116
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPOCK1
Proper citation: Atlas Antibodies Cat# HPA007450, RRID:AB_10603116 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848665
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): C1orf112
Proper citation: Atlas Antibodies Cat# HPA023778, RRID:AB_1848665 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844595
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YLKEHSIETFLTLRCTQKRKEEKAMIAKMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFLGRAIDARSIDRLRS; Manufacturer approved use: ICC-IF, IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): ADCY5
Proper citation: Atlas Antibodies Cat# HPA017730, RRID:AB_1844595 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2173752
Comments: Discontinued; Applications: WB (1:10,000-1:20,000), IP (5-10 µg/mg lysate)
Host Organism: rabbit
Clonality: polyclonal
Target(s): Pumilio 2
Proper citation: Thermo Fisher Scientific Cat# A300-202A, RRID:AB_2173752 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852228
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): KRT23
Proper citation: Atlas Antibodies Cat# HPA016959, RRID:AB_1852228 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079638
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PLXNB2
Proper citation: Atlas Antibodies Cat# HPA003100, RRID:AB_1079638 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2185280
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EASYLAEVFGPLWIVKVYSYEFQKPSLCFCCPETVEADKGQRGGAARPADQETPPAPPVQVQHLSYNYS; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): SERINC4
Proper citation: Atlas Antibodies Cat# HPA018526, RRID:AB_2185280 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_577215
Comments: Discontinued; Applications: WB (1:2,000-1:10,000), IHC (1:200-1:1,000), IP (2-5 µg/mg lysate)
Host Organism: rabbit
Clonality: polyclonal
Target(s): SUPT6H
Proper citation: Thermo Fisher Scientific Cat# A300-801A, RRID:AB_577215 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960385
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Clonality: polyclonal
Target(s): THAP11 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA041434, RRID:AB_10960385 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1158146
Comments: Used By NYUIHC-1057
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality: monoclonal
Target(s): ND
Proper citation: Cell Marque Cat# 120M-85, RRID:AB_1158146 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079451
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human NCBP2L
Proper citation: Sigma-Aldrich Cat# HPA010664, RRID:AB_1079451 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078980
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human GLUL
Proper citation: Sigma-Aldrich Cat# HPA007571, RRID:AB_1078980 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854773
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): OGDH antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA020347, RRID:AB_1854773 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854144
Comments: Vendor recommendations: Immunohistochemistry; Immunofluorescence; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): RPS6KA4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA023225, RRID:AB_1854144 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078369
Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): CDH1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA004812, RRID:AB_1078369 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848533
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): FGL2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA026682, RRID:AB_1848533 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.