Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-FAM36A antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA043617, RRID:AB_10965694 FAM36A antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10965694 Sigma-Aldrich HPA043617 2025-08-19 11:20:30 0
Anti-NECAB1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA025963, RRID:AB_1848015 NECAB1 antibody produced in rabbit human Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other polyclonal rabbit AB_1848015 Sigma-Aldrich HPA025963 2025-08-19 11:20:41 0
Anti-TNFSF18 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA012699, RRID:AB_1849698 TNFSF18 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS; Manufacturer approved use: IHC, WB polyclonal rabbit AB_1849698 Atlas Antibodies HPA012699 2025-08-19 11:21:06 0
Anti-DPYSL2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA002381, RRID:AB_1847244 Human DPYSL2 human Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1847244 Sigma-Aldrich HPA002381 2025-08-19 11:21:12 0
Anti-ADPRHL2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA027141, RRID:AB_1844619 Human ADPRHL2 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1844619 Sigma-Aldrich HPA027141 2025-08-19 11:21:09 0
Anti-TMEM146 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA024056, RRID:AB_1858093 Human TMEM146 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1858093 Sigma-Aldrich HPA024056 2025-08-19 11:21:15 0
Anti-KCNQ5 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA016655, RRID:AB_1855557 Human KCNQ5 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1855557 Sigma-Aldrich HPA016655 2025-08-19 11:21:09 0
Anti-LMBRD1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA019547, RRID:AB_2281256 LMBRD1 human Useful for immunohistochemistry polyclonal rabbit AB_2281256 Sigma-Aldrich HPA019547 2025-08-19 11:21:35 0
Mouse Anti-Gelsolin Monoclonal Antibody, Unconjugated, Clone GS-2C4
 
Resource Report
Resource Website
Rating or validation data
Abcam Cat# ab11081, RRID:AB_297732 Gelsolin porcine, cow, rabbit, bovine, human Clone GS-2C4 Applications: Affinity purification, ELISA, Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Fr, Other, Western Blot
Validation: data for WB is available from YCharOS. https://doi.org/10.5281/zenodo.4724188
monoclonal mouse AB_297732 Abcam ab11081 2025-08-19 11:25:32 0
Anti-ANKRD2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA040842, RRID:AB_10963794 ANKRD2 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable polyclonal AB_10963794 Sigma-Aldrich HPA040842 2025-08-19 11:26:00 0
ANTI-APPL1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA011138, RRID:AB_1844959 ANTI-APPL1 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Western Blot; Immunofluorescence; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1844959 Sigma-Aldrich HPA011138 2025-08-19 11:25:59 0
Anti-EFHA1 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA045511, RRID:AB_10959894 EFHA1 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable polyclonal AB_10959894 Sigma-Aldrich HPA045511 2025-08-19 11:25:53 2
Anti-HSPBAP1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA044930, RRID:AB_10961122 HSPBAP1 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10961122 Sigma-Aldrich HPA044930 2025-08-19 11:25:52 0
Anti-ARIH1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA003295, RRID:AB_1845017 ARIH1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1845017 Atlas Antibodies HPA003295 2025-08-19 11:25:59 0
Anti-ENPEP antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA005128, RRID:AB_1844795 Human ENPEP human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1844795 Sigma-Aldrich HPA005128 2025-08-19 11:25:59 0
Anti-Adenovirus, clone 20/11
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Millipore Cat# MAB8052, RRID:AB_95243 Adenovirus clone 20/11 h seller recommendations: IgG1; IgG1 Immunohistochemistry; ELISA; Flow Cytometry; Immunofluorescence; Immunocytochemistry; ELISA, FC, IF, IH, IH(P)
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal mouse AB_95243 Millipore MAB8052 2025-08-19 11:26:11 2
Anti-IDH1 R132H (Hu) from Mouse (H09) – unconj
 
Resource Report
Resource Website
10+ mentions
Rating or validation data
Dianova Cat# DIA-H09, RRID:AB_2335716 IDH1 R132H human H09 Applications: Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections), Western Blot
Used By NYUIHC-872. Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal mouse AB_2335716 Dianova DIA-H09 2025-08-19 11:26:19 14
Rabbit Anti-Histone H2A.Z, C-terminus Polyclonal antibody, Unconjugated
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Millipore Cat# 07-594, RRID:AB_390152 Histone H2A.Z, C-terminus human seller recommendations: Western Blot; Western Blotting polyclonal rabbit AB_390152 Millipore 07-594 2025-08-19 11:26:20 1
Anti-PARD6B antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA013376, RRID:AB_1854972 Human PARD6B human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1854972 Sigma-Aldrich HPA013376 2025-08-19 11:26:26 0
Anti-KRT20 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA024309, RRID:AB_1852220 Human KRT20 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1852220 Sigma-Aldrich HPA024309 2025-08-19 11:26:37 2

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.