Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
URL: http://antibodyregistry.org/AB_2684859
Proper Citation: Atlas Antibodies Cat# HPA062740, RRID:AB_2684859
Target Antigen: OSCAR
Host Organism: rabbit
Clonality: polyclonal
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGSYRCCYRRPDW; Manufacturer approved use: ICC-IF
Expand AllWe found {{ ctrl2.mentions.all_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
A list of researchers who have used the resource and an author search tool
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No alerts have been found for Anti-OSCAR polyclonal antibody.
Source: Antibody Registry
dkNET can assist you in preparing authentication plans for antibodies to comply with the NIH Submission Policy. The information can be used while planning your experiments or submitting grant applications. The authentication plan for antibodies is based on methods suggested in "A proposal for validation of antibodies" (Uhlen M et. al., 2016), the guideline published in the Journal of Comparative Neurology (Saper C, 2005)(2), and the example " Authentication of of Key Biological and/or Chemical Resources "(Bandrowski A). For best practices for authenticating antibodies, check our Authentication Reports services.