Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
URL: http://antibodyregistry.org/AB_2492388
Proper Citation: Biosensis Cat# GP-029-50, RRID:AB_2492388
Target Antigen: A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
Host Organism: guinea pig
Clonality: unknown
Comments: IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Expand AllWe found {{ ctrl2.mentions.all_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
A list of researchers who have used the resource and an author search tool
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No rating or validation information has been found for Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum.
No alerts have been found for Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum.
Source: Antibody Registry
dkNET can assist you in preparing authentication plans for antibodies to comply with the NIH Submission Policy. The information can be used while planning your experiments or submitting grant applications. The authentication plan for antibodies is based on methods suggested in "A proposal for validation of antibodies" (Uhlen M et. al., 2016), the guideline published in the Journal of Comparative Neurology (Saper C, 2005)(2), and the example " Authentication of of Key Biological and/or Chemical Resources "(Bandrowski A). For best practices for authenticating antibodies, check our Authentication Reports services.