Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 97 showing 1921 ~ 1940 out of 2,249 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_117992

http://www.addgene.org/117992

Species: Arabidopsis thaliana
Genetic Insert: CTP-CURT_fluoE
Vector Backbone Description: Backbone Size:9204; Vector Backbone:pN_35S; Vector Types:Plant Expression, Synthetic Biology, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30884945

Proper citation: RRID:Addgene_117992 Copy   


  • RRID:Addgene_117991

http://www.addgene.org/117991

Species: Arabidopsis thaliana
Genetic Insert: CTP-CURT_fluoB
Vector Backbone Description: Backbone Size:9204; Vector Backbone:pN_35S; Vector Types:Plant Expression, Synthetic Biology, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30884945

Proper citation: RRID:Addgene_117991 Copy   


  • RRID:Addgene_117998

http://www.addgene.org/117998

Species: Arabidopsis thaliana
Genetic Insert: CURT_fluoA
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:3956; Vector Backbone:pBAD; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945

Proper citation: RRID:Addgene_117998 Copy   


  • RRID:Addgene_117903

http://www.addgene.org/117903

Species: Arabidopsis thaliana
Genetic Insert: AtCOPT6 upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHGNMPPSSPSSMVNHTNSNMIMMHMTFFWGKNTEILFSGWPGTSLGMYVLCLIVVFLLAVIVEWLAHSSILRGRGSTSRAKGLVQTAVYTLKTGLAYLVMLAVMSFNGGVFIVAIAGFAVGFMLFGSTAFKNPSDDEKPFEQLENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH

Proper citation: RRID:Addgene_117903 Copy   


  • RRID:Addgene_118001

http://www.addgene.org/118001

Species: Arabidopsis thaliana
Genetic Insert: CURT_flouD
Vector Backbone Description: Backbone Marker:Agilent Technologies; Backbone Size:6571; Vector Backbone:pESC-URA; Vector Types:Yeast Expression, Yeast/bacteria binary vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945

Proper citation: RRID:Addgene_118001 Copy   


http://www.addgene.org/118000

Species: Arabidopsis thaliana
Genetic Insert: Derlin1-mOrange2
Vector Backbone Description: Backbone Size:2028; Vector Backbone:pN_35S/mCitrine (Addgene plasmid 117993); Vector Types:Plant Expression, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30884945

Proper citation: RRID:Addgene_118000 Copy   


http://www.addgene.org/118686

Species: Arabidopsis thaliana
Genetic Insert: BPC4
Vector Backbone Description: Vector Backbone:pENTR; Vector Types:Other; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications: Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
 Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
   
 Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9

Proper citation: RRID:Addgene_118686 Copy   


  • RRID:Addgene_118689

http://www.addgene.org/118689

Species: Arabidopsis thaliana
Genetic Insert: AT3G07200
Vector Backbone Description: Vector Backbone:pER8 cHA; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:28400782
Comments: 28 C in GV3101 (pMP90) strain Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications: Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
 Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
   
 Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9

Proper citation: RRID:Addgene_118689 Copy   


  • RRID:Addgene_118683

    This resource has 1+ mentions.

http://www.addgene.org/118683

Species: Arabidopsis thaliana
Genetic Insert: PHL2
Vector Backbone Description: Vector Backbone:pDONR 221; Vector Types:Other; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications: Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
 Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
   
 Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9

Proper citation: RRID:Addgene_118683 Copy   


http://www.addgene.org/118684

Species: Arabidopsis thaliana
Genetic Insert: XERICO
Vector Backbone Description: Vector Backbone:pDONR 221; Vector Types:Other; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications: Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
 Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
   
 Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9

Proper citation: RRID:Addgene_118684 Copy   


  • RRID:Addgene_118690

http://www.addgene.org/118690

Species: Arabidopsis thaliana
Genetic Insert: XERICO
Vector Backbone Description: Vector Backbone:pER8 cHA; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:28400782
Comments: 28 C in GV3101 (pMP90) strain Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications: Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
 Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
   
 Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9

Proper citation: RRID:Addgene_118690 Copy   


  • RRID:Addgene_118676

http://www.addgene.org/118676

Species: Arabidopsis thaliana
Genetic Insert: PHL2
Vector Backbone Description: Vector Backbone:pDEST 566; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications: Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
 Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
   
 Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9

Proper citation: RRID:Addgene_118676 Copy   


  • RRID:Addgene_118672

http://www.addgene.org/118672

Species: Arabidopsis thaliana
Genetic Insert: PHL2
Vector Backbone Description: Vector Backbone:pDEST 544; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications: Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
 Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
   
 Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9

Proper citation: RRID:Addgene_118672 Copy   


  • RRID:Addgene_118673

http://www.addgene.org/118673

Species: Arabidopsis thaliana
Genetic Insert: XERICO
Vector Backbone Description: Vector Backbone:pDEST 544; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications: Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
 Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
   
 Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9

Proper citation: RRID:Addgene_118673 Copy   


http://www.addgene.org/118680

Species: Arabidopsis thaliana
Genetic Insert: BPC4
Vector Backbone Description: Vector Backbone:pDONR 221; Vector Types:Other; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications: Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
 Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
   
 Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9

Proper citation: RRID:Addgene_118680 Copy   


  • RRID:Addgene_118665

http://www.addgene.org/118665

Species: Arabidopsis thaliana
Genetic Insert: AT3G07200
Vector Backbone Description: Vector Backbone:pBA cHA; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:28400782
Comments: 28 C in GV3101 (pMP90) strain Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications: Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
 Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
   
 Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9

Proper citation: RRID:Addgene_118665 Copy   


  • RRID:Addgene_118668

http://www.addgene.org/118668

Species: Arabidopsis thaliana
Genetic Insert: BPC4
Vector Backbone Description: Vector Backbone:pBA cMYC; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:28400782
Comments: 28 C in GV3101 (pMP90) strain Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications: Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
 Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
   
 Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9

Proper citation: RRID:Addgene_118668 Copy   


  • RRID:Addgene_118670

http://www.addgene.org/118670

Species: Arabidopsis thaliana
Genetic Insert: PHL2
Vector Backbone Description: Vector Backbone:pDEST 527; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications: Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
 Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
   
 Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9

Proper citation: RRID:Addgene_118670 Copy   


  • RRID:Addgene_118963

http://www.addgene.org/118963

Species: Arabidopsis thaliana
Genetic Insert: Cas13a
Vector Backbone Description: Vector Backbone:PUC19MinusMCS; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29301551

Proper citation: RRID:Addgene_118963 Copy   


  • RRID:Addgene_118937

http://www.addgene.org/118937

Species: Arabidopsis thaliana
Genetic Insert: SOMA Sensor for Arabidopsis MAPK activity with Nuclear Localization Signal
Vector Backbone Description: Vector Backbone:pCAMBIA-1300; Vector Types:Plant Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30444549
Comments: The Eevee Linker present in this plasmid was invented by Prof. Michiyuki Matsuda at Kyoto University. The Eevee Linker has been patented by Kyoto University. The plasmid backbone used to produce the SOMA sensor was a kind gift of Michiyuki Matsuda and Kazuhiro Aoki. Please note there are some sequence discrepancies between the Addgene quality control sequence and the author-supplied Genbank sequence. The authors have noted that the discrepancies do NOT affect plasmid function.

Proper citation: RRID:Addgene_118937 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X