Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pET-SOMA-T679A Resource Report Resource Website |
RRID:Addgene_118936 | SOMA FRET sensor for measuring MAPK activity in Arabidopsis thaliana with T679A Mutation | Arabidopsis thaliana | Ampicillin | PMID:30444549 | The Eevee Linker present in this plasmid was invented by Prof. Michiyuki Matsuda at Kyoto University. The Eevee Linker has been patented by Kyoto University. The plasmid backbone used to produce the SOMA sensor was a kind gift of Michiyuki Matsuda and Kazuhiro Aoki. Please note there are some sequence discrepancies between the Addgene quality control sequence and the author-supplied Genbank sequence. The authors have noted that the discrepancies do NOT affect plasmid function. | Vector Backbone:pET-32(a)+; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:03 | 0 | |
|
pSOMA-T679A-NLS Resource Report Resource Website |
RRID:Addgene_118938 | SOMA Sensor for Arabidopsis MAPK activity with T679A Mutation and Nuclear Localization Signal | Arabidopsis thaliana | Kanamycin | PMID:30444549 | The Eevee Linker present in this plasmid was invented by Prof. Michiyuki Matsuda at Kyoto University. The Eevee Linker has been patented by Kyoto University. The plasmid backbone used to produce the SOMA sensor was a kind gift of Michiyuki Matsuda and Kazuhiro Aoki. Please note there are some sequence discrepancies between the Addgene quality control sequence and the author-supplied Genbank sequence. The authors have noted that the discrepancies do NOT affect plasmid function. | Vector Backbone:pCAMBIA-1300; Vector Types:Plant Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:53:00 | 0 | |
|
pET-SOMA Resource Report Resource Website |
RRID:Addgene_118935 | SOMA FRET sensor for measuring MAPK activity in Arabidopsis thaliana | Arabidopsis thaliana | Ampicillin | PMID:30444549 | The Eevee Linker present in this plasmid was invented by Prof. Michiyuki Matsuda at Kyoto University. The Eevee Linker has been patented by Kyoto University. The plasmid backbone used to produce the SOMA sensor was a kind gift of Michiyuki Matsuda and Kazuhiro Aoki. Please note there are some sequence discrepancies between the Addgene quality control sequence and the author-supplied Genbank sequence. The authors have noted that the discrepancies do NOT affect plasmid function. | Vector Backbone:pET-32(a)+; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:00 | 0 | |
|
Tom20-CIB-GFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_117242 | CIBN | Arabidopsis thaliana | Kanamycin | PMID:31582560 | Please visit https://www.biorxiv.org/content/10.1101/551788v3 for bioRxiv preprint. | Backbone Marker:Genlantis; Backbone Size:4962; Vector Backbone:phCMV-NGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:52:42 | 2 | |
|
LBJJ491 Resource Report Resource Website 1+ mentions |
RRID:Addgene_117513 | BsaI:GGAG:pYAO:AATG:BsaI | Arabidopsis thaliana | Spectinomycin | PMID:30625150 | Cloned by Laurence Tomlinson . Please visit https://www.biorxiv.org/content/early/2018/09/17/419952 for bioRxiv preprint. | Backbone Size:2247; Vector Backbone:pICH41295; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin | 2026-08-29 12:52:47 | 1 | |
|
BCJJ339 Resource Report Resource Website |
RRID:Addgene_117501 | BpiI:GCAA:RPS5a:Cas9-3(intron):E9:ACTA:BpiI | Arabidopsis thaliana | Ampicillin | PMID:30625150 | Cloned by Baptiste Castel . Please visit https://www.biorxiv.org/content/early/2018/09/17/419952 for bioRxiv preprint. | Backbone Size:4352; Vector Backbone:pICH47742; Vector Types:Plant Expression, CRISPR; Bacterial Resistance:Ampicillin | 2026-08-29 12:52:45 | 0 | |
|
LBJJ433 Resource Report Resource Website |
RRID:Addgene_117507 | BsaI:GGAG:pEC1.2:AATG:BsaI | Arabidopsis thaliana | Spectinomycin | PMID:30625150 | Cloned by Laurence Tomlinson . Please visit https://www.biorxiv.org/content/early/2018/09/17/419952 for bioRxiv preprint. | Backbone Size:2247; Vector Backbone:pICH41295; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin | 2026-08-29 12:52:45 | 0 | |
|
pICSL12015 Resource Report Resource Website |
RRID:Addgene_117506 | BsaI:GGAG:pUBI10:AATG:BsaI | Arabidopsis thaliana | Spectinomycin | PMID:30625150 | Cloned by Mark Youles . Please visit https://www.biorxiv.org/content/early/2018/09/17/419952 for bioRxiv preprint. | Backbone Size:2247; Vector Backbone:pICH41295; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin | 2026-08-29 12:52:47 | 0 | |
|
LBJJ432 Resource Report Resource Website |
RRID:Addgene_117508 | BsaI:GGAG:pEC_enh:AATG:BsaI | Arabidopsis thaliana | Spectinomycin | PMID:30625150 | Cloned by Laurence Tomlison . Please visit https://www.biorxiv.org/content/early/2018/09/17/419952 for bioRxiv preprint. | Backbone Size:2247; Vector Backbone:pICH41295; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin | 2026-08-29 12:52:47 | 0 | |
|
pICSL11015 Resource Report Resource Website 1+ mentions |
RRID:Addgene_117499 | BpiI:TGCC:pOLE1:OLE1-RFP:OLE1t:GCAA:BpiI | Arabidopsis thaliana | Ampicillin | PMID:30625150 | Cloned by Mark Youles . Please visit https://www.biorxiv.org/content/early/2018/09/17/419952 for bioRxiv preprint. | Backbone Size:4352; Vector Backbone:pICH47732; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:52:47 | 3 | |
|
AtALMT1-uPIC 5' Resource Report Resource Website |
RRID:Addgene_117886 | AtALMT1-uPIC 5' | Arabidopsis thaliana | Bleocin (Zeocin) | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-08-29 12:52:50 | 0 | |||
|
CHL1 P492L-eGFP Resource Report Resource Website |
RRID:Addgene_117882 | CHL1 | Arabidopsis thaliana | Bleocin (Zeocin) | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | P492L | 2026-08-29 12:52:50 | 0 | ||
|
CHL1 P492L Resource Report Resource Website |
RRID:Addgene_117881 | CHL1 P492L | Arabidopsis thaliana | Bleocin (Zeocin) | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | P429L | 2026-08-29 12:52:52 | 0 | ||
|
AtALMT1-uPIC 3' Resource Report Resource Website |
RRID:Addgene_117888 | AtALMT1-uPIC 3' | Arabidopsis thaliana | Bleocin (Zeocin) | insert amino acid sequence: MLLASNFDTLSHFLQDFGDEYFEAREKGDYKVVEKRKKNLERYKSVLDSKSDEEALANYAEWEPPHGQFRFRHPWKQYVAVGALLRQCAYRIDALNSYINSDFQIPVDIKKKLETPLRRMSSESGNSMKEMSISLKQMIKSSSSDIHVSNSQAACKSLSTLLKSGILNDVEPLQMISLMTTVSMLIDIVNLTEKISESVHELASAARFKNKMRPTVLYEKSDSGSIGRAMPIDSHEDHHVVTVLHDVDNDRSNNVDDSRGGSSQDSCHHVAIKIVDDNSNHEKHEDGEIHVHTLSNGHLQALNLSSGENLYFQSVDHHHHHH- | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-08-29 12:52:52 | 0 | ||
|
CHL1 wt Resource Report Resource Website |
RRID:Addgene_117875 | CHL1 wt | Arabidopsis thaliana | Bleocin (Zeocin) | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-08-29 12:52:49 | 0 | |||
|
CHL1 wt-eGFP Resource Report Resource Website |
RRID:Addgene_117876 | CHL1 wt-eGFP | Arabidopsis thaliana | Bleocin (Zeocin) | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-08-29 12:52:52 | 0 | |||
|
CHL1 T101D Resource Report Resource Website |
RRID:Addgene_117879 | CHL1 T101D | Arabidopsis thaliana | Bleocin (Zeocin) | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | T101D | 2026-08-29 12:52:52 | 0 | ||
|
CBL5-upGFP Resource Report Resource Website |
RRID:Addgene_117869 | CBL5-upGFP | Arabidopsis thaliana | Bleocin (Zeocin) | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-08-29 12:52:49 | 0 | |||
|
AtCOPT6 uPIC Resource Report Resource Website |
RRID:Addgene_117902 | AtCOPT6 uPIC | Arabidopsis thaliana | Bleocin (Zeocin) | insert amino acid sequence: MDHGNMPPSSPSSMVNHTNSNMIMMHMTFFWGKNTEILFSGWPGTSLGMYVLCLIVVFLLAVIVEWLAHSSILRGRGSTSRAKGLVQTAVYTLKTGLAYLVMLAVMSFNGGVFIVAIAGFAVGFMLFGSTAFKNPSDDEKPFEQLENLYQSHHHHHH | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-08-29 12:52:50 | 0 | ||
|
AtPQL upGFP Resource Report Resource Website |
RRID:Addgene_117897 | AtPQL upGFP | Arabidopsis thaliana | Bleocin (Zeocin) | insert amino acid sequence: MIRDDLSLSLGIISVISWSVAEIPQIMTNYNQKSIEGVSITFLTTWMLGDIFNVVGCLMEPASLPVQFYTAVLYTLATLVLYVQSIYYGHIYPRLMKNRRNHQMVDVEEPLLREEAKRPSTKSLLCVVSVFLFLGSFNVLSGSRSMDLRGKDRVFVVGGAGARKLLEVSSGNLGENNNIGMWLGWAMAAIYMGGRLPQICMNVRRGNVEGLNPLMFFFAFIGNVTYVASILVNSVEWSKIEPNLPWLVDSGGCAVLDFLILLQFFYFHCRKVEADSVKKKHETGEEAVENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-08-29 12:52:50 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.