Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Rattus norvegicus
Genetic Insert: tdTomato-P2A-paCaMKII(T286A)
Vector Backbone Description: Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495
Proper citation: RRID:Addgene_165432 Copy
Species: Rattus norvegicus
Genetic Insert: FHS-paCaMKII(SD)
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495
Proper citation: RRID:Addgene_165430 Copy
Species: Rattus norvegicus
Genetic Insert: tdTomato-P2A-paCaMKII(K42M)
Vector Backbone Description: Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495
Proper citation: RRID:Addgene_165433 Copy
Species: Rattus norvegicus
Genetic Insert: mEGFP(A206K)-paCaMKII
Vector Backbone Description: Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495
Comments: Only tested in HeLa cells, but not in neurons.
Proper citation: RRID:Addgene_165438 Copy
Species: Rattus norvegicus
Genetic Insert: iGluSnFR extracellular domain fused to TARP gamma-8 via NETO2 TM domain
Vector Backbone Description: Backbone Size:3950; Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36622100
Comments: Chimera of iGluSnFR (Addgene plasmid # 41732), Neto2 and Gamma-8
pAAV backbone is based on Addgene plasmid # 61463
Please visit https://doi.org/10.1101/2021.01.21.427382 for bioRxiv preprint.
Proper citation: RRID:Addgene_165498 Copy
Species: Rattus norvegicus
Genetic Insert: Cb5 tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: "KITTVESNSSWWTNWVIPAISALVVALMYRLYMAED" amino acid targeting sequence, which we refer to as "Cb5", for endoplasmic reticulum targeting. "7aa" indicates the 7 amino acid flexible linker region between Venus and the Cb5 targeting signal.
Proper citation: RRID:Addgene_166764 Copy
Species: Rattus norvegicus
Genetic Insert: p58
Vector Backbone Description: Vector Backbone:Halo; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33852913
Comments: Depositor confirms mutations in p58 (L405Q, R419S) do not affect plasmid function.
Proper citation: RRID:Addgene_166896 Copy
Species: Rattus norvegicus
Genetic Insert: p58
Vector Backbone Description: Vector Backbone:GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:11706049
Comments: Please note there are two mutations in p58-L405Q, R419S Depositor confirms these do not affect plasmid function.
Proper citation: RRID:Addgene_166942 Copy
Species: Rattus norvegicus
Genetic Insert: ZAP
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5100; Vector Backbone:pCDNA4 TO2 myc HisB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12215647
Comments: The NZAP fragment was excised from pBabe-NZAP-Zeo with EcoRI-NotI and cloned into pCDNA4/TO2-myc-HisB to generate a myc-tagged
NZAP. The C-terminal portion of ZAP was cloned from a Rat2 cell cDNA library by PCR using sense primer CZAP-SP (5’-GAGCTCTCTGGGCTTAACC-3’) and antisense primer CZAP-AP (5’-
ATATAGGCGGCCGCCCTCTGGACCTCTTCTCTTC-3’). The sense primer lies
upstream from an internal NheI site in NZAP; the antisense primer introduces a NotI site immediately downstream from the coding sequence to facilitate its cloning into the myc-tagged expression vector.
Proper citation: RRID:Addgene_17381 Copy
Species: Rattus norvegicus
Genetic Insert: NZAP
Vector Backbone Description: Backbone Marker:Goff Lab; Backbone Size:0; Vector Backbone:pBabe-HAZ (modified pBabe vector); Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12215647
Proper citation: RRID:Addgene_17382 Copy
Species: Rattus norvegicus
Genetic Insert: PKC beta 1
Vector Backbone Description: Backbone Size:5400; Vector Backbone:pHACE; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12794082
Comments: From user-provided sequence (see 'Reviews'), there are five amino acid differences from one of two NCBI reference sequences (AAA41868.1 and NP_001165776.1): 25A, 62F, 64K, 69C, and 294G. These "mutations" are also present in human, bovine, and xenopus sequences. An additional C-terminal mutation, H579Y, is present. These mutations are not believed to affect function.
Proper citation: RRID:Addgene_16379 Copy
Species: Rattus norvegicus
Genetic Insert: PKC beta 1
Vector Backbone Description: Backbone Size:5400; Vector Backbone:pHACE; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12794082
Comments: From user-provided sequence (see 'Reviews'), there are five amino acid differences from one of two NCBI reference sequences (AAA41868.1 and NP_001165776.1): 25A, 62F, 64K, 69C, and 294G. These "mutations" are also present in human, bovine, and xenopus sequences and are therefore not believed to affect function.
Proper citation: RRID:Addgene_16378 Copy
Species: Rattus norvegicus
Genetic Insert: PKC beta 1
Vector Backbone Description: Backbone Size:5400; Vector Backbone:pHACE; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12794082
Proper citation: RRID:Addgene_16380 Copy
Species: Rattus norvegicus
Genetic Insert: LAMP1
Vector Backbone Description: Vector Backbone:N/A; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31539493
Proper citation: RRID:Addgene_164215 Copy
Species: Rattus norvegicus
Genetic Insert: LAMP1
Vector Backbone Description: Vector Backbone:N/A; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31539493
Proper citation: RRID:Addgene_164216 Copy
Species: Rattus norvegicus
Genetic Insert: rat Δ188Annexin A11
Vector Backbone Description: Backbone Marker:Gunter Stier; Vector Backbone:pET; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32344647
Proper citation: RRID:Addgene_164497 Copy
Species: Rattus norvegicus
Genetic Insert: rat Δ192Annexin A11
Vector Backbone Description: Backbone Marker:Gunter Stier; Vector Backbone:pET; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32344647
Proper citation: RRID:Addgene_164498 Copy
Species: Rattus norvegicus
Genetic Insert: VAMP2
Vector Backbone Description: Vector Backbone:pBa-eGFP-SBP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34731031
Proper citation: RRID:Addgene_180249 Copy
Species: Rattus norvegicus
Genetic Insert: lysosome associated membrane protein 1
Vector Backbone Description: Backbone Marker:BD Biosciences / Clontech; Backbone Size:4700; Vector Backbone:pEYFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:14617360
Comments: Lamp-1 sequence contains a D50E mutation, which is not important for function of plasmid. There is also a silent mutation at bp#715 compared to GenBank NM_012857.1
Proper citation: RRID:Addgene_1816 Copy
Species: Rattus norvegicus
Genetic Insert: lysosome associated membrane protein 1
Vector Backbone Description: Backbone Size:4700; Vector Backbone:Modified Clontech Plasmid; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:14617360
Comments: Lamp-1 sequence contains a D50E mutation, which is not important for function of plasmid. There is also a silent mutation at bp#715 compared to GenBank NM_012857.1
Proper citation: RRID:Addgene_1817 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
