Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Rattus norvegicus
Genetic Insert: Npl4
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:3000; Vector Backbone:pET30; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:15371428
Proper citation: RRID:Addgene_21267 Copy
Species: Rattus norvegicus
Genetic Insert: rho/rac guanine nucleotide exchange factor (GEF) 2
Vector Backbone Description: Backbone Marker:Available from Addgene (#14883); Backbone Size:9941; Vector Backbone:FUGW; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:19208802
Proper citation: RRID:Addgene_21477 Copy
Species: Rattus norvegicus
Genetic Insert: Dazl
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:4911; Vector Backbone:pcDNA; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: Day 25 cDNA TD197b/TD198.
Dazl sequence was determined and designed based on coding sequence available for rat genome in 2003. There may be a few discrepancies with the currently available sequence, most notably a C-terminal truncation and point mutation causing P196S.
Proper citation: RRID:Addgene_21623 Copy
Species: Rattus norvegicus
Genetic Insert: Dazl shRNA-2
Vector Backbone Description: Backbone Size:8264; Vector Backbone:pLLU2G; Vector Types:Lentiviral, RNAi, Cre/Lox; Bacterial Resistance:Ampicillin
Comments: Dazl shRNA sequence is - 5'-TTTGTTGATCCAGGAGCTGACCTTCAAGAGAGGTCAGCTCCTGGATCAACTTTT
Proper citation: RRID:Addgene_21622 Copy
Species: Rattus norvegicus
Genetic Insert: mitogen-activated protein kinase kinase kinase 1
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:10400; Vector Backbone:pCEP4; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:7624324
Comments: full length MEKK1
Proper citation: RRID:Addgene_21632 Copy
Species: Rattus norvegicus
Genetic Insert: mTOR (1750-2549)
Vector Backbone Description: Backbone Marker:BD Pharmingen; Backbone Size:4754; Vector Backbone:pRK5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12718876
Proper citation: RRID:Addgene_21747 Copy
Species: Rattus norvegicus
Genetic Insert: mTOR (1-1482)
Vector Backbone Description: Backbone Marker:BD Pharmingen; Backbone Size:4754; Vector Backbone:pRK5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12718876
Proper citation: RRID:Addgene_21745 Copy
Species: Rattus norvegicus
Genetic Insert: myosin 1b isoform b motor domain
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4694; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26195670
Comments: PCR cloning at EcoRI-XbaI DNA fragment was generated by PCR on rat Myo1b cDNA with 5' primer ATGGCCAAGAAGGAGGTAAAAT and 3' primer CTGATATCGCTTTTGTTGCGCGT
Proper citation: RRID:Addgene_187364 Copy
Species: Rattus norvegicus
Genetic Insert: Synaptotagmin 2
Vector Backbone Description: Vector Backbone:pTEV5; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35322233
Proper citation: RRID:Addgene_186688 Copy
Species: Rattus norvegicus
Genetic Insert: Fra1
Vector Backbone Description: Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15618352
Proper citation: RRID:Addgene_187906 Copy
Species: Rattus norvegicus
Genetic Insert: TEF2p-Scarlet(rfp)-Link-2xPH
Vector Backbone Description: Vector Backbone:pYTK089 (ColE1, AmpR); Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35708612
Comments: Part of the Markerless Yeast Localization and Overexpression (MyLO) CRISPR-Cas9 Toolkit. Vector cloned using BsaI Golden Gate cloning
Proper citation: RRID:Addgene_179074 Copy
Species: Rattus norvegicus
Genetic Insert: TDH3p-Scarlet(rfp)-Link-2xPH
Vector Backbone Description: Vector Backbone:pYTK089 (ColE1, AmpR); Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35708612
Comments: Part of the Markerless Yeast Localization and Overexpression (MyLO) CRISPR-Cas9 Toolkit. Vector cloned using BsaI Golden Gate cloning
Proper citation: RRID:Addgene_179073 Copy
Species: Rattus norvegicus
Genetic Insert: TDH3p-Neon(gfp)-Link-2xPH(PLCd)
Vector Backbone Description: Vector Backbone:pYTK089 (ColE1, AmpR); Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35708612
Comments: Part of the Markerless Yeast Localization and Overexpression (MyLO) CRISPR-Cas9 Toolkit. Vector cloned using BsaI Golden Gate cloning
Proper citation: RRID:Addgene_179072 Copy
Species: Rattus norvegicus
Genetic Insert: mVenus-TrkC
Vector Backbone Description: Backbone Marker:Kinsella, T. M., and Nolan, G. P; Backbone Size:11471; Vector Backbone:LZRSpBMN-Z; Vector Types:Mammalian Expression, Retroviral, Synthetic Biology; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_182948 Copy
Species: Rattus norvegicus
Genetic Insert: TRk-C-mCherry
Vector Backbone Description: Backbone Marker:Kinsella, T.M., and Nolan, G.P; Backbone Size:11652; Vector Backbone:LZRSpBMN-Z; Vector Types:Mammalian Expression, Retroviral, Synthetic Biology; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_182949 Copy
Species: Rattus norvegicus
Genetic Insert: SLC6A4 Serotonin Transporter
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:11592963
Comments: Please also see:
Zhang YW, Turk BE, Rudnick G. Control of serotonin transporter phosphorylation by conformational state. Proc Natl Acad Sci U S A. 2016 May 17;113(20):E2776-83. doi: 10.1073/pnas.1603282113. Epub 2016 May 2. PMID: 27140629; PMCID: PMC4878475.
Proper citation: RRID:Addgene_190743 Copy
Species: Rattus norvegicus
Genetic Insert: rat serotonin transporter
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA 3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17008313
Proper citation: RRID:Addgene_190177 Copy
Species: Rattus norvegicus
Genetic Insert: mScarlet-AMPKalpha2
Vector Backbone Description: Backbone Size:3994; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35790710
Proper citation: RRID:Addgene_192451 Copy
Species: Rattus norvegicus
Genetic Insert: GCaMP6s
Vector Backbone Description: Backbone Marker:n/a; Backbone Size:2900; Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37163565
Comments: Please visit https://www.biorxiv.org/content/10.1101/2022.10.17.512455v2 for bioRxiv preprint.
Proper citation: RRID:Addgene_192945 Copy
Species: Rattus norvegicus
Genetic Insert: Cb5 tail anchor
Vector Backbone Description: Vector Backbone:pLVX-EF1a-IRES-Puromycin; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Comments: Infection with this plasmid will express mCherry-fused to the N-terminus of Cb5 tail anchor sequence" "ITTVESNSSWWTNWVIPAISALVVALMYRLYMAED", which targets the cytoplasmic face of endoplasmic reticulum. There is a flexible, 7 aa linker "SGLRSGK", between mCherry and Cb5.
Proper citation: RRID:Addgene_177434 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
