Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Synthetic
Genetic Insert: colEdes2/Imdes2
Vector Backbone Description: Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30538236
Comments: Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes2: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWKEVAKDPDLAKQFKRANRRNIKQGRAPFAPKKDQVGGRRTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes2: MELKHSISDYTEAEFLEFVKKIYNSTDEEKQKELVTEFERLTEHPSGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH
Proper citation: RRID:Addgene_107109 Copy
Species: Synthetic
Genetic Insert: F37A+L196F+V252A+C253G-hADPRM GST-mutant cADPR phosphohydrolase gene
Vector Backbone Description: Backbone Marker:GE Healthcare; Backbone Size:4946; Vector Backbone:pGEX-6P-3; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29348648
Proper citation: RRID:Addgene_107163 Copy
Species: Synthetic
Genetic Insert: PLL 2.4
Vector Backbone Description: Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30018322
Proper citation: RRID:Addgene_107205 Copy
Species: Synthetic
Genetic Insert: PLL 2.2
Vector Backbone Description: Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30018322
Proper citation: RRID:Addgene_107203 Copy
Species: Synthetic
Genetic Insert: xyl3.1
Vector Backbone Description: Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30018322
Proper citation: RRID:Addgene_107209 Copy
Species: Synthetic
Genetic Insert: PLL 4.1
Vector Backbone Description: Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30018322
Proper citation: RRID:Addgene_107208 Copy
Species: Synthetic
Genetic Insert: PLL 3.1
Vector Backbone Description: Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30018322
Proper citation: RRID:Addgene_107207 Copy
Species: Synthetic
Genetic Insert: GFP + sgRNA for GFP
Vector Backbone Description: Vector Backbone:pXPR_047; Vector Types:Mammalian Expression, Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Comments: gRNA sequence is GGTGAACCGCATCGAGCTGA
pLKO TRC v2 library vector, Puro selection and eGFP expression.
Proper citation: RRID:Addgene_107145 Copy
Species: Synthetic
Genetic Insert: xyl8.2
Vector Backbone Description: Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30018322
Proper citation: RRID:Addgene_107216 Copy
Species: Synthetic
Genetic Insert: ecAT3.10
Vector Backbone Description: Backbone Marker:modified from Invitrogen; Backbone Size:5000; Vector Backbone:pCMV(MinDis) [variant of pDisplay]; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29121644
Proper citation: RRID:Addgene_107215 Copy
Species: Synthetic
Genetic Insert: xyl8.1
Vector Backbone Description: Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30018322
Proper citation: RRID:Addgene_107214 Copy
Species: Synthetic
Genetic Insert: xyl4.2
Vector Backbone Description: Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30018322
Proper citation: RRID:Addgene_107213 Copy
Species: Synthetic
Genetic Insert: xyl3.2
Vector Backbone Description: Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30018322
Proper citation: RRID:Addgene_107210 Copy
Species: Synthetic
Genetic Insert: 24xPP7v3
Vector Backbone Description: Vector Backbone:pUC57; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29281824
Proper citation: RRID:Addgene_107230 Copy
Species: Synthetic
Genetic Insert: 1D3-28Z. 1-3 mut
Vector Backbone Description: Backbone Size:5586; Vector Backbone:MSGV1; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20631379
Proper citation: RRID:Addgene_107227 Copy
Species: Synthetic
Genetic Insert: 1D3-28Z All ITAMs intact
Vector Backbone Description: Backbone Size:5584; Vector Backbone:MSGV1; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20631379
Proper citation: RRID:Addgene_107226 Copy
Species: Synthetic
Genetic Insert: SpCas9-SaCas9 fusion
Vector Backbone Description: Vector Backbone:pCSDest2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30451839
Proper citation: RRID:Addgene_107319 Copy
Species: Synthetic
Genetic Insert: SpCas9-SaCas9 fusion
Vector Backbone Description: Vector Backbone:pCSDest2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30451839
Proper citation: RRID:Addgene_107318 Copy
Species: Synthetic
Genetic Insert: SpCas9-NmCas9 fusion
Vector Backbone Description: Vector Backbone:pCSDest2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30451839
Proper citation: RRID:Addgene_107326 Copy
Species: Synthetic
Genetic Insert: SpCas9-NmCas9 fusion
Vector Backbone Description: Vector Backbone:pCSDest2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30451839
Proper citation: RRID:Addgene_107325 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.