Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Synthetic
Genetic Insert: EGFP-uTEV1-MAVS(tmd)[R537A, R538A]
Vector Backbone Description: Backbone Size:8000; Vector Backbone:pCW-Cas9; Vector Types:Mammalian Expression, Lentiviral, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34414886
Proper citation: RRID:Addgene_171000 Copy
Species: Synthetic
Genetic Insert: anti-vimentin-nanobody VB6 (NbVim) tagged with circularly permutated superfolderGFP(cp10GFP)
Vector Backbone Description: Backbone Marker:invitrogen; Backbone Size:3300; Vector Backbone:modified pcDNA3.1; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34090210
Proper citation: RRID:Addgene_171020 Copy
Species: Synthetic
Genetic Insert: 14x-His-bdSUMO-HA2-muGFP-HiBiT
Vector Backbone Description: Backbone Size:4694; Vector Backbone:pET His6 MBP TEV LIC cloning vector (2M-T); Vector Types:Bacterial Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34140497
Comments: Please visit https://www.biorxiv.org/content/10.1101/2020.08.20.258350v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_171017 Copy
Species: Synthetic
Genetic Insert: 14x-His-bdSUMO-pHD118-muGFP-HiBiT
Vector Backbone Description: Backbone Size:4694; Vector Backbone:pET His6 MBP TEV LIC cloning vector (2M-T); Vector Types:Bacterial Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34140497
Comments: Please visit https://www.biorxiv.org/content/10.1101/2020.08.20.258350v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_171015 Copy
Species: Synthetic
Genetic Insert: 14x-His-bdSUMO-5.3-muGFP-HiBiT
Vector Backbone Description: Backbone Size:4694; Vector Backbone:pET His6 MBP TEV LIC cloning vector (2M-T); Vector Types:Bacterial Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34140497
Comments: Please visit https://www.biorxiv.org/content/10.1101/2020.08.20.258350v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_171014 Copy
Species: Synthetic
Genetic Insert: EGFP-uTEV1-SQS(FL)
Vector Backbone Description: Backbone Size:8000; Vector Backbone:pCW-Cas9; Vector Types:Mammalian Expression, Lentiviral, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34414886
Proper citation: RRID:Addgene_171010 Copy
Species: Synthetic
Genetic Insert: J3(106)- BBa_J23111-sfGFP
Vector Backbone Description: Backbone Marker:Jesse Zalatan; Backbone Size:6102; Vector Backbone:pGNW2-pp2; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33930546
Comments: Alternative names: pCK306, pGNW2-pp2_J3(106)-BBa_J23111-sfGFP
Single cross-over into P. putida. Then, kanamycin resistant marker can be flipped out by pCK255
Proper citation: RRID:Addgene_171153 Copy
Species: Synthetic
Genetic Insert: J306 scRNA
Vector Backbone Description: Backbone Marker:Jesse Zalatan; Backbone Size:6261; Vector Backbone:pPPC020.306; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Gentamicin
Defining Citation: PMID:33930546
Comments: Alternative names: pCK162, pBBR1-GmR_J3-BBa_J23117-mvaES
Proper citation: RRID:Addgene_171151 Copy
Species: Synthetic
Genetic Insert: Cas12f1
Vector Backbone Description: Backbone Size:8576; Vector Backbone:pCas; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34023220
Proper citation: RRID:Addgene_171182 Copy
Species: Synthetic
Genetic Insert: hAAVS1 scRNA
Vector Backbone Description: Backbone Marker:Kenneth M. Peterson; Backbone Size:5148; Vector Backbone:pBBR1-MCS2; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33930546
Comments: Alternative names: pCK041.AAV, pBBR1-KmR_Sp.pCas9-dCas9_BBa_J23107-MCP-SoxS(R93A/S101A)_AAV
Proper citation: RRID:Addgene_171175 Copy
Species: Synthetic
Genetic Insert: J306 scRNA
Vector Backbone Description: Backbone Marker:Jesse Zalatan; Backbone Size:6261; Vector Backbone:pPPC020.306; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Gentamicin
Defining Citation: PMID:33930546
Comments: Alternative names: pCK134, pBBR1-GmR_J3-BBa_J23117-GTPCH_J3-BBa_J23117-PTPS_J3-BBa_J23117-SR
Proper citation: RRID:Addgene_171149 Copy
Species: Synthetic
Genetic Insert: hAAVS1 scRNA
Vector Backbone Description: Backbone Marker:Jesse Zalatan; Backbone Size:4577; Vector Backbone:pRK2-KmR; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33930546
Comments: Alternative names: pCK080, pRK2-KmR_J1-BBa_J23117-mRFP_hAAVS1.
Proper citation: RRID:Addgene_171147 Copy
Species: Synthetic
Genetic Insert: J109 scRNA
Vector Backbone Description: Backbone Marker:Kenneth M. Peterson; Backbone Size:5148; Vector Backbone:pBBR1-MCS2; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33930546
Comments: Alternative names: pCK058, pBBR1-KmR_J1-mRFP_J109
Proper citation: RRID:Addgene_171145 Copy
Species: Synthetic
Genetic Insert: J106 scRNA
Vector Backbone Description: Backbone Marker:Kenneth M. Peterson; Backbone Size:5148; Vector Backbone:pBBR1-MCS2; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33930546
Comments: Alternative names: pCK033.06, pBBR1-KmR_J106
Proper citation: RRID:Addgene_171142 Copy
Species: Synthetic
Genetic Insert: J1-BBa_J23117-sfGFP
Vector Backbone Description: Backbone Marker:Herbert Schweizer; Backbone Size:4569; Vector Backbone:pUC18TminiTn7T-Gm; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Gentamicin
Defining Citation: PMID:33930546
Comments: Alternative names: pCDP009, pUC18TminiTn7T-Gm_J1-BBa_J23117-sfGFP_Sp.pCas9-dCas9_BBa_J23107-MCP-SoxS(R93A/S101A)
Used for conjugation, with pTNS1 and pRK2013 helper plasmids, to integrate J1-BBa_J23117-sfGFP, Sp.pCas9-dCas9, and BBa_J23107-MCP-SoxS(R93A/S101A) cassettes into gram-negative bacteria.
Point mutation in the FRT site was observed and remained applicable with counterselection by pCK255
Proper citation: RRID:Addgene_171139 Copy
Species: Synthetic
Genetic Insert: SaCas9
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
Comments: YFP sgRNA for SaCas9
Proper citation: RRID:Addgene_107050 Copy
Species: Synthetic
Genetic Insert: SaCas9
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
Comments: LacZ sgRNA for SaCas9
Proper citation: RRID:Addgene_107049 Copy
Species: Synthetic
Genetic Insert: colEdes12/Imdes12
Vector Backbone Description: Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30538236
Comments: Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes12: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFKKKFWKEVSKDPDLSKQFKGSNRENIKQGIAPFARQKDQVGGRRVFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes12: MELKHSISDYTEAEFLEFVKEICQKNSAGELDESLFKLVTEFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH
Proper citation: RRID:Addgene_107120 Copy
Species: Synthetic
Genetic Insert: M. sedula PCNA1 fused to CyPet
Vector Backbone Description: Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27228945
Proper citation: RRID:Addgene_107085 Copy
Species: Synthetic
Genetic Insert: S. solfataricus PCNA3 fused to YPet
Vector Backbone Description: Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27228945
Proper citation: RRID:Addgene_107084 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.