Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Norway

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Organism:rattus norvegicus (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

2,177 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pBactin-Nedd1-mOrange2-rCM1
 
Resource Report
Resource Website 		RRID:Addgene_196861 Nedd1-mOrange2-rCM1 Rattus norvegicus Ampicillin PMID:36796357 Backbone Size:8089; Vector Backbone:pBeta-actin-Nedd1-mOrange2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:30 0
pBactin-Nedd1-mOrange2
 
Resource Report
Resource Website 		RRID:Addgene_196860 Nedd1-mOrange2 Rattus norvegicus Ampicillin PMID:36796357 Backbone Size:6040; Vector Backbone:pBeta-actin-Tubg1-mEGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:29 0
pBactin-Nedd1-mOrange2-F75A
 
Resource Report
Resource Website 		RRID:Addgene_196862 Nedd1-mOrange2-F75A Rattus norvegicus Ampicillin PMID:36796357 Backbone Size:8089; Vector Backbone:pBeta-actin-Nedd1-mOrange2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin F75A in the CM1 domain 2026-08-15 01:26:28 0
pBactin-AcGFP-128-425-Akap9
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_196871 AcGFP-Akap9 (128-425) Rattus norvegicus Ampicillin PMID:36796357 Backbone Size:6000; Vector Backbone:pBeta-actin; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:30 1
pCI pHluorin Syt4
 
Resource Report
Resource Website 		RRID:Addgene_184505 Synaptotagmin 4 Rattus norvegicus Ampicillin PMID:22398727 The first codon of the Synpatotagmin has been removed Backbone Marker:Promega; Backbone Size:4006; Vector Backbone:pCI; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:28 0
pBactin-td-mCherry-Cdk5rap2
 
Resource Report
Resource Website 		RRID:Addgene_196859 td-mCherry-Cdk5rap2 Rattus norvegicus Ampicillin PMID:36796357 Backbone Size:7437; Vector Backbone:pBeta-actin-td-mCherry-CI; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:28 0
pBactin-AcGFP-Cdk5rap2-CTD
 
Resource Report
Resource Website 		RRID:Addgene_196853 AcGFP-Cdk5rap2-CTD Rattus norvegicus Ampicillin PMID:36796357 Backbone Size:6748; Vector Backbone:pBeta-actin-AcGFP-CI ; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin None (wt) 2026-08-15 01:26:30 0
pDS170-enNTS1
 
Resource Report
Resource Website 		RRID:Addgene_199152 enNTS1 Rattus norvegicus Ampicillin PMID:36680775 For additional information, please refer to: Bumbak et al. 2018 "Optimization and 13CH3 methionine labeling of a signaling competent neurotensin receptor 1 variant for NMR studies" BBA Biomembranes. https://doi.org/10.1016/j.bbamem.2018.03.020 Bumbak et al. 2019 "Expression and Purification of a Functional E. coli 13CH3-Methionine-Labeled Thermostable Neurotensin Receptor 1 Variant for Solution NMR Studies" Methods Mol Biol. https://doi.org/10.1007/978-1-4939-9121-1_3 Backbone Marker:Internal Lab Plasmid; Backbone Size:6112; Vector Backbone:pDS170; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin V208M, C273S, C391S and C393S (over NTS1-B5) 2026-08-15 01:26:31 0
PGK mScarlet-LC3B
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_200083 Map1lc3b Rattus norvegicus Kanamycin PMID:37133994 Backbone Marker:Clontech; Backbone Size:3900; Vector Backbone:pEGFPc/PGK; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:26:32 1
pcDNA3.1_rSERT_WT
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_190743 SLC6A4 Serotonin Transporter Rattus norvegicus Ampicillin PMID:11592963 Please also see: Zhang YW, Turk BE, Rudnick G. Control of serotonin transporter phosphorylation by conformational state. Proc Natl Acad Sci U S A. 2016 May 17;113(20):E2776-83. doi: 10.1073/pnas.1603282113. Epub 2016 May 2. PMID: 27140629; PMCID: PMC4878475. Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:24:33 1
pcDNA3.1_rSERT_X5C_S277C
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_190177 rat serotonin transporter Rattus norvegicus Ampicillin PMID:17008313 Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA 3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin Cys15Ala, Cys21Ala, Cys109Ala, Ser277Cys, Cys357Ile, Cys622Ala 2026-08-15 01:24:33 1
pEGFP-C1-mScarlet-AMPKα2
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_192451 mScarlet-AMPKalpha2 Rattus norvegicus Kanamycin PMID:35790710 Backbone Size:3994; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:24:33 1
pAAV-OTp-GCaMP6s
 
Resource Report
Resource Website 		RRID:Addgene_192945 GCaMP6s Rattus norvegicus Ampicillin PMID:37163565 Please visit https://www.biorxiv.org/content/10.1101/2022.10.17.512455v2 for bioRxiv preprint. Backbone Marker:n/a; Backbone Size:2900; Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin 2026-08-15 01:24:35 0
mCherry-Cb5-IRES-puromycin-pLVx-EF1a
 
Resource Report
Resource Website 		RRID:Addgene_177434 Cb5 tail anchor Rattus norvegicus Ampicillin Infection with this plasmid will express mCherry-fused to the N-terminus of Cb5 tail anchor sequence" "ITTVESNSSWWTNWVIPAISALVVALMYRLYMAED", which targets the cytoplasmic face of endoplasmic reticulum. There is a flexible, 7 aa linker "SGLRSGK", between mCherry and Cb5. Vector Backbone:pLVX-EF1a-IRES-Puromycin; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-08-15 01:24:38 0
pAAV-hSyn-fDIO-mScarlet-Gphn_P1
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_194972 mScarlet-Gphn (isoform P1) Rattus norvegicus Ampicillin PMID:36543537 Backbone Marker:Stratagene; Backbone Size:3892; Vector Backbone:pAAV-MCS; Vector Types:AAV; Bacterial Resistance:Ampicillin 2026-08-15 01:25:09 2
PH-miRFP-FRB
 
Resource Report
Resource Website 		RRID:Addgene_193568 PH domain from PLC delta1 Rattus norvegicus Kanamycin PMID:36759616 Please visit https://doi.org/10.1101/2022.03.21.485138 for bioRxiv preprint. Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin PH domain 2026-08-15 01:25:08 0
pMyosin-miRFP718nano
 
Resource Report
Resource Website 		RRID:Addgene_195748 miRFP718nano-LC-Myosin Rattus norvegicus Ampicillin PMID:36456785 Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:25:10 0
pEPOZ0CM0137
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_197535 C-terminal glucocorticoid receptor, GR Rattus norvegicus Chloramphenicol PMID:37856867 Please visit https://doi.org/10.1101/2023.02.13.528283 for bioRxiv preprint. Vector Backbone:pUAP4; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol 2026-08-15 01:26:00 1
pGADT7-AP-2 σ2
 
Resource Report
Resource Website 		RRID:Addgene_198345 AP-2 σ2 Rattus norvegicus Ampicillin PMID:35976721 Backbone Size:7987; Vector Backbone:pGADT7; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin R42G substitution, and silent substitutions in codons 3, 4, 5, 138 and 140 2026-08-15 01:26:01 0
pACT2-μ3B
 
Resource Report
Resource Website 		RRID:Addgene_198175 AP-3 μ3B Rattus norvegicus Ampicillin PMID:24229647 Backbone Size:8117; Vector Backbone:pACT2; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:00 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

dkNET community events and announcements in August, 2026

HIRN Funding Opportunity: SPARKS Award

Join the Whole Person Physiome 1st Data Jamboree on August 24-25

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch