Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Organism:e. coli (facet)


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

1,737 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
pFF828
 
Resource Report
Resource Website
RRID:Addgene_61456 msd_lacZ(ON) E. coli Chloramphenicol PMID:25395541 Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol 2026-08-15 01:17:42 0
pFF838
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_61457 SCRIBE_lacZ(ON) E. coli Chloramphenicol PMID:25395541 Vector Backbone:pZA31; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol 2026-08-15 01:17:42 1
pFF746
 
Resource Report
Resource Website
RRID:Addgene_61451 SCRIBE_galK(ON) E. coli Kanamycin PMID:25395541 Backbone Marker:Expressys; Vector Backbone:pZA21; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:17:42 0
pFF749
 
Resource Report
Resource Website
RRID:Addgene_61452 msd_kanR(ON)_dRT E. coli Chloramphenicol PMID:25395541 Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol D197A D198A 2026-08-15 01:17:42 0
pFF753
 
Resource Report
Resource Website
RRID:Addgene_61453 msd(wt) E. coli Chloramphenicol PMID:25395541 Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol 2026-08-15 01:17:42 0
pFF530
 
Resource Report
Resource Website
RRID:Addgene_61447 msd_kanR(ON) E. coli Chloramphenicol PMID:25395541 Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol 2026-08-15 01:17:42 0
pFF706
 
Resource Report
Resource Website
RRID:Addgene_61448 SCRIBE_kanR(ON) E. coli Chloramphenicol PMID:25395541 Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol 2026-08-15 01:17:42 0
pFF714
 
Resource Report
Resource Website
RRID:Addgene_61449 SCRIBE_galK(OFF) E. coli Chloramphenicol PMID:25395541 Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol 2026-08-15 01:17:42 0
pKS1
 
Resource Report
Resource Website
RRID:Addgene_24636 'tesA E. coli Chloramphenicol PMID:20111002 EJ Steen et al. 2009 Nature 10.1038/nature08721 Backbone Size:0; Vector Backbone:p15a; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Chloramphenicol 2026-08-15 01:12:32 0
pMA2641
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_25435 reverse tetracycline-regulated transactivator advanced E. coli Ampicillin PMID:19655272 Backbone Marker:unpublished; Backbone Size:7200; Vector Backbone:pMA2635rc; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin 2026-08-15 01:12:41 1
pTH
 
Resource Report
Resource Website
RRID:Addgene_56659 KanR E. coli Kanamycin PMID:25302562 Note: There are some small discrepancies between Addgene's quality control sequence and the assembled sequence from the depositor. They should not affect the function of the plasmid. Backbone Size:4361; Vector Backbone:pBR322; Vector Types:Synthetic Biology, Diatom Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:17:00 0
pJB042 (FtsZ-mEos2)
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_49764 FtsZ-mEos2 E. coli Chloramphenicol PMID:23859153 Backbone Marker:NBRP-E.coli at NIG; Backbone Size:4500; Vector Backbone:pCA24N; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol 2026-08-15 01:16:03 1
pB33eCPX
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_23336 Enhanced Circularly Permuted Outer Membrane Protein X E. coli Chloramphenicol PMID:18480093 Backbone Size:5400; Vector Backbone:pBAD33; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol 2026-08-15 01:12:19 8
R4-LexAp65-R3
 
Resource Report
Resource Website
RRID:Addgene_41438 LexAp65 E. coli Kanamycin Backbone Marker:Invitrogen; Backbone Size:2664; Vector Backbone:pDONR P4r-P3r; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:14:45 0
pSigma54-4
 
Resource Report
Resource Website
RRID:Addgene_41748 rpoN E. coli Ampicillin PMID:22341441 Backbone Marker:novagen; Backbone Size:5708; Vector Backbone:pET15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin c198a c307g c346a 2026-08-15 01:14:48 0
pCMVlac-dirTopo-AU1-aGFP
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_61971 lacZ alpha E. coli Kanamycin Vector Backbone:pEGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin It contains silent mutations 2026-08-15 01:17:48 1
MG1655-tMMR
 
Resource Report
Resource Website
RRID:Addgene_62392 MG1655-tMMR E. coli Tetracycline PMID:24500200 For detailed use and MAGE, see: 1. Nyerges, Á. et al. Conditional DNA repair mutants enable highly precise genome engineering. Nucl. Acids Res. 42, e62–e62 (2014). 2. Gallagher, R. R., Li, Z., Lewis, A. O. & Isaacs, F. J. Rapid editing and evolution of bacterial genomes using libraries of synthetic DNA. Nat. Protocols 9, 2301–2316 (2014). 3. Bonde, M. T., Anderson, M. V., Wallin, A. I. N., Wang, H. H. & Sommer, M. O. A. MODEST: a web-based design tool for oligonucleotide-mediated genome engineering and recombineering. Nucl. Acids Res. (2014). doi:10.1093/nar/gku428 Vector Backbone:genomic; Vector Types:; Bacterial Resistance:Tetracycline mutS(A134V) mutL(G62S); nadA::Tn10 pglΔ8 [λ cI857 Δ(cro-bioA)]} 2026-08-15 01:17:52 0
pJexpress414_OmpA171_WT
 
Resource Report
Resource Website
RRID:Addgene_62646 OmpA E. coli Ampicillin PMID:26199411 AA sequence: MKKTAIAIAVALAGFATVAQAAPNDNTWYTGAKLGWSQYHDTGFI NNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLG YPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWT NNIGDYPYDVPDYATRPDNGMLSLGVSYRFGCCPGCCHHHHHH Backbone Marker:DNA2.0; Backbone Size:4000; Vector Backbone:pJexpress414; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin 2026-08-15 01:17:54 0
C321
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_48999 Recoded E. coli genome with all instances of the UAG codon removed, but wild type UAG termination function is not changed E. coli Ampicillin PMID:24136966 E. coli MG1655 delta(ybhB-bioAB)::[lcI857 N(cro-ea59)::tetR-bla] Delta mutS::zeoR; all 321 UAG codons changed to UAA This strain is mutS-, which causes a spontaneous mutation frequency of ~2E-8. This strain is auxotrophic for d-biotin. Sequence is similar to C321.DA (NCBI accession # NCBI CP006698), except that RF1 is not deleted. Vector Backbone:E. coli genome; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin See genbank file of C321.DA 2026-08-15 01:15:55 3
pAmeR-F1
 
Resource Report
Resource Website
RRID:Addgene_74675 PTac-RBSF1-AmeR-PAmeR-YFP E. coli Kanamycin PMID:27034378 Backbone Marker:Alec Nielsen; Backbone Size:3930; Vector Backbone:pAN801; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:19:39 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.