Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 55 showing 1081 ~ 1100 out of 1,737 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_61456

http://www.addgene.org/61456

Species: E. coli
Genetic Insert: msd_lacZ(ON)
Vector Backbone Description: Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541

Proper citation: RRID:Addgene_61456 Copy   


  • RRID:Addgene_61457

    This resource has 1+ mentions.

http://www.addgene.org/61457

Species: E. coli
Genetic Insert: SCRIBE_lacZ(ON)
Vector Backbone Description: Vector Backbone:pZA31; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541

Proper citation: RRID:Addgene_61457 Copy   


  • RRID:Addgene_61451

http://www.addgene.org/61451

Species: E. coli
Genetic Insert: SCRIBE_galK(ON)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZA21; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25395541

Proper citation: RRID:Addgene_61451 Copy   


  • RRID:Addgene_61452

http://www.addgene.org/61452

Species: E. coli
Genetic Insert: msd_kanR(ON)_dRT
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541

Proper citation: RRID:Addgene_61452 Copy   


  • RRID:Addgene_61453

http://www.addgene.org/61453

Species: E. coli
Genetic Insert: msd(wt)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541

Proper citation: RRID:Addgene_61453 Copy   


  • RRID:Addgene_61447

http://www.addgene.org/61447

Species: E. coli
Genetic Insert: msd_kanR(ON)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541

Proper citation: RRID:Addgene_61447 Copy   


  • RRID:Addgene_61448

http://www.addgene.org/61448

Species: E. coli
Genetic Insert: SCRIBE_kanR(ON)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541

Proper citation: RRID:Addgene_61448 Copy   


  • RRID:Addgene_61449

http://www.addgene.org/61449

Species: E. coli
Genetic Insert: SCRIBE_galK(OFF)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541

Proper citation: RRID:Addgene_61449 Copy   


  • RRID:Addgene_24636

http://www.addgene.org/24636

Species: E. coli
Genetic Insert: 'tesA
Vector Backbone Description: Backbone Size:0; Vector Backbone:p15a; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:20111002
Comments: EJ Steen et al. 2009 Nature 10.1038/nature08721

Proper citation: RRID:Addgene_24636 Copy   


  • RRID:Addgene_25435

    This resource has 1+ mentions.

http://www.addgene.org/25435

Species: E. coli
Genetic Insert: reverse tetracycline-regulated transactivator advanced
Vector Backbone Description: Backbone Marker:unpublished; Backbone Size:7200; Vector Backbone:pMA2635rc; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:19655272

Proper citation: RRID:Addgene_25435 Copy   


  • RRID:Addgene_56659

http://www.addgene.org/56659

Species: E. coli
Genetic Insert: KanR
Vector Backbone Description: Backbone Size:4361; Vector Backbone:pBR322; Vector Types:Synthetic Biology, Diatom Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25302562
Comments: Note: There are some small discrepancies between Addgene's quality control sequence and the assembled sequence from the depositor. They should not affect the function of the plasmid.

Proper citation: RRID:Addgene_56659 Copy   


  • RRID:Addgene_49764

    This resource has 1+ mentions.

http://www.addgene.org/49764

Species: E. coli
Genetic Insert: FtsZ-mEos2
Vector Backbone Description: Backbone Marker:NBRP-E.coli at NIG; Backbone Size:4500; Vector Backbone:pCA24N; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:23859153

Proper citation: RRID:Addgene_49764 Copy   


  • RRID:Addgene_23336

    This resource has 1+ mentions.

http://www.addgene.org/23336

Species: E. coli
Genetic Insert: Enhanced Circularly Permuted Outer Membrane Protein X
Vector Backbone Description: Backbone Size:5400; Vector Backbone:pBAD33; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:18480093

Proper citation: RRID:Addgene_23336 Copy   


  • RRID:Addgene_41438

http://www.addgene.org/41438

Species: E. coli
Genetic Insert: LexAp65
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:2664; Vector Backbone:pDONR P4r-P3r; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin

Proper citation: RRID:Addgene_41438 Copy   


  • RRID:Addgene_41748

http://www.addgene.org/41748

Species: E. coli
Genetic Insert: rpoN
Vector Backbone Description: Backbone Marker:novagen; Backbone Size:5708; Vector Backbone:pET15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:22341441

Proper citation: RRID:Addgene_41748 Copy   


  • RRID:Addgene_61971

    This resource has 1+ mentions.

http://www.addgene.org/61971

Species: E. coli
Genetic Insert: lacZ alpha
Vector Backbone Description: Vector Backbone:pEGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin

Proper citation: RRID:Addgene_61971 Copy   


  • RRID:Addgene_62392

http://www.addgene.org/62392

Species: E. coli
Genetic Insert: MG1655-tMMR
Vector Backbone Description: Vector Backbone:genomic; Vector Types:; Bacterial Resistance:Tetracycline
Defining Citation: PMID:24500200
Comments: For detailed use and MAGE, see: 1. Nyerges, Á. et al. Conditional DNA repair mutants enable highly precise genome engineering. Nucl. Acids Res. 42, e62–e62 (2014). 2. Gallagher, R. R., Li, Z., Lewis, A. O. & Isaacs, F. J. Rapid editing and evolution of bacterial genomes using libraries of synthetic DNA. Nat. Protocols 9, 2301–2316 (2014). 3. Bonde, M. T., Anderson, M. V., Wallin, A. I. N., Wang, H. H. & Sommer, M. O. A. MODEST: a web-based design tool for oligonucleotide-mediated genome engineering and recombineering. Nucl. Acids Res. (2014). doi:10.1093/nar/gku428

Proper citation: RRID:Addgene_62392 Copy   


http://www.addgene.org/62646

Species: E. coli
Genetic Insert: OmpA
Vector Backbone Description: Backbone Marker:DNA2.0; Backbone Size:4000; Vector Backbone:pJexpress414; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26199411
Comments: AA sequence: MKKTAIAIAVALAGFATVAQAAPNDNTWYTGAKLGWSQYHDTGFI NNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLG YPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWT NNIGDYPYDVPDYATRPDNGMLSLGVSYRFGCCPGCCHHHHHH

Proper citation: RRID:Addgene_62646 Copy   


  • RRID:Addgene_48999

    This resource has 1+ mentions.

http://www.addgene.org/48999

Species: E. coli
Genetic Insert: Recoded E. coli genome with all instances of the UAG codon removed, but wild type UAG termination function is not changed
Vector Backbone Description: Vector Backbone:E. coli genome; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24136966
Comments: E. coli MG1655 delta(ybhB-bioAB)::[lcI857 N(cro-ea59)::tetR-bla] Delta mutS::zeoR; all 321 UAG codons changed to UAA This strain is mutS-, which causes a spontaneous mutation frequency of ~2E-8. This strain is auxotrophic for d-biotin. Sequence is similar to C321.DA (NCBI accession # NCBI CP006698), except that RF1 is not deleted.

Proper citation: RRID:Addgene_48999 Copy   


  • RRID:Addgene_74675

http://www.addgene.org/74675

Species: E. coli
Genetic Insert: PTac-RBSF1-AmeR-PAmeR-YFP
Vector Backbone Description: Backbone Marker:Alec Nielsen; Backbone Size:3930; Vector Backbone:pAN801; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:27034378

Proper citation: RRID:Addgene_74675 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X