Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Organism:rattus norvegicus (facet)


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

2,177 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
pEF HaloTag-SYT1
 
Resource Report
Resource Website
RRID:Addgene_197280 SYT1 and HaloTag Rattus norvegicus Ampicillin PMID:36729040 Please visit https://www.biorxiv.org/content/10.1101/2022.02.08.479521v1 for bioRxiv preprint. Vector Backbone:pEF (#11154); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:27:17 0
pEF Synaptophysin-GCamp6s
 
Resource Report
Resource Website
RRID:Addgene_188981 Synaptophysin Rattus norvegicus Ampicillin PMID:29754754 Vector Backbone:pEF; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:24:28 0
pcDNA3.1_rSERT_C109A_Y107C
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_190174 SLC6A4 Serotonin Transporter Rattus norvegicus Ampicillin PMID:17698848 Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA 3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin changed Cys109 to alanine, changed tyr107 to cysteine 2026-08-15 01:24:33 1
pEGFP-C1-3x-NLS-mScarlet-AMPKα2
 
Resource Report
Resource Website
RRID:Addgene_192452 3x-NLS-mScarlet-AMPKalpha2 Rattus norvegicus Kanamycin PMID:35790710 Backbone Size:3994; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:24:33 0
mCherry-7aa-cb5-pEGFP-C1
 
Resource Report
Resource Website
RRID:Addgene_177407 Cb5 tail anchor Rattus norvegicus Kanamycin Transfection of this plasmid will express mCherry-fused to the N-terminus of Cb5 tail anchor sequence" "ITTVESNSSWWTNWVIPAISALVVALMYRLYMAED", which targets the cytoplasmic face of endoplasmic reticulum. There is a flexible, 7 aa linker "SGLRSGK", between mCherry and Cb5. Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:24:38 0
MUNC13-1 MUN
 
Resource Report
Resource Website
RRID:Addgene_218889 MUNC13-1 MUN domain Rattus norvegicus Ampicillin PMID:38956381 Vector Backbone:pTEV; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:30:40 0
pCAG-2dV-Camui (T286A)
 
Resource Report
Resource Website
RRID:Addgene_220367 mVenus(Y145W)-mVenus(Y145W)-rat CaMK2 alpha(T286A)-mEGFP(A206K) Rattus norvegicus Ampicillin PMID:39385027 Please visit https://www.biorxiv.org/content/10.1101/2023.08.01.549180v1.full.pdf for bioRxiv preprint. Backbone Size:4758; Vector Backbone:pCAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin changed Threonine 286 to Alanine 2026-08-15 01:30:50 0
pCAG-2dV-Camui (T305D/T306D)
 
Resource Report
Resource Website
RRID:Addgene_220368 mVenus(Y145W)-mVenus(Y145W)-rat CaMK2 alpha(T305D/T306D)-mEGFP(A206K) Rattus norvegicus Ampicillin PMID:39385027 Please visit https://www.biorxiv.org/content/10.1101/2023.08.01.549180v1.full.pdf for bioRxiv preprint. Backbone Size:4758; Vector Backbone:pCAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin changed both Threonine 305 and 306 to aspartic acid 2026-08-15 01:30:50 0
FUGW-RUSH-LAMP1-mScarleti
 
Resource Report
Resource Website
RRID:Addgene_228526 LAMP1 Rattus norvegicus Ampicillin PMID:40016183 Please visit https://doi.org/10.1101/2024.05.16.594502 for bioRxiv preprint. Backbone Size:10726; Vector Backbone:FUWG-RUSH-Strep-KDEL; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-08-15 01:32:01 0
pAAV-Rat SARE-Arc Min Promoter-Flag Arc-Arc Genomic 3'UTR
 
Resource Report
Resource Website
RRID:Addgene_233056 Rat Arc Rattus norvegicus Ampicillin Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin 2026-08-15 01:32:21 0
mRFP-LAP2β
 
Resource Report
Resource Website
RRID:Addgene_228029 LAP2b Rattus norvegicus Ampicillin PMID:37098350 Vector Backbone:n/a; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-08-15 01:31:23 0
pLV-RnSyt1-sgRNA3-dCas9-KRAB-TagBFP2 (Identifier AAAA-0247)
 
Resource Report
Resource Website
RRID:Addgene_202556 CRISPRi single guide RNA sequence against 5’-UTR of rat synaptotagmin-1 (Syt1) gene (insert 5’ - CACCTCCTCCTGCAGCGGCAGCATCGG) Rattus norvegicus Ampicillin PMID:37226896 Backbone Marker:Dr Konstantin Kogan; Backbone Size:14900; Vector Backbone:pLV-hUV6-sgRNA-dCas9-KRAB-TagBFP; Vector Types:Lentiviral, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:31:29 0
macroH2A1.2-GFP (pc2189)
 
Resource Report
Resource Website
RRID:Addgene_223708 macroH2A1.2-GFP Rattus norvegicus Kanamycin PMID:39189450 Backbone Size:4733; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:30:56 0
pX552-hsyn DIO GCaMP8f(with gRNA scaffold)
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_199580 His-DIO GCaMP8f Rattus norvegicus Ampicillin PMID:38871457 pX552 was a gift from Feng Zhang (Addgene plasmid # 60958 ; http://n2t.net/addgene:60958 ; RRID:Addgene_60958) Backbone Size:4699; Vector Backbone:pX552; Vector Types:Mammalian Expression, AAV, Cre/Lox, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:31:07 1
pMRX-IPU-SNAP-Omp25
 
Resource Report
Resource Website
RRID:Addgene_228137 Omp25 Rattus norvegicus Ampicillin PMID:39288101 Backbone Size:6101; Vector Backbone:pMRX-IPU; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin transmembrane region (C-terminus) 2026-08-15 01:31:19 0
pAAV-CMV-Flag-Rat Arc-Arc- Genomic 3'UTR
 
Resource Report
Resource Website
RRID:Addgene_233053 Rat Arc Rattus norvegicus Ampicillin Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin 2026-08-15 01:32:03 0
pAIP4_1EYH
 
Resource Report
Resource Website
RRID:Addgene_234159 1EYH Rattus norvegicus Kanamycin PMID:42555168 5' cloning site: BsaI (destroyed), 3' cloning site: BsaI (destroyed) Backbone Size:5679; Vector Backbone:pET29b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:32:05 0
pET28-NFMshuf1
 
Resource Report
Resource Website
RRID:Addgene_232058 Neurofilament-Medium tail domain, charge shuffle 1 Rattus norvegicus Kanamycin PMID:39602260 Backbone Size:5200; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:32:03 0
pET28-NFHtail
 
Resource Report
Resource Website
RRID:Addgene_232057 Neurofilament-Heavy tail domain Rattus norvegicus Kanamycin PMID:39602260 Backbone Size:5200; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin added N-terminal tryptophan and tyrosine, and cysteine for surface grafting 2026-08-15 01:32:04 0
pET28-NFMtail
 
Resource Report
Resource Website
RRID:Addgene_232056 Neurofilament-Medium tail domain Rattus norvegicus Kanamycin PMID:39602260 Backbone Size:5200; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin cDNA codon-optimized for E. coli; added N-terminal tryptophan and tyrosine, and cysteine for surface grafting 2026-08-15 01:32:03 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.