Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pEF HaloTag-SYT1 Resource Report Resource Website |
RRID:Addgene_197280 | SYT1 and HaloTag | Rattus norvegicus | Ampicillin | PMID:36729040 | Please visit https://www.biorxiv.org/content/10.1101/2022.02.08.479521v1 for bioRxiv preprint. | Vector Backbone:pEF (#11154); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:27:17 | 0 | |
|
pEF Synaptophysin-GCamp6s Resource Report Resource Website |
RRID:Addgene_188981 | Synaptophysin | Rattus norvegicus | Ampicillin | PMID:29754754 | Vector Backbone:pEF; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:24:28 | 0 | ||
|
pcDNA3.1_rSERT_C109A_Y107C Resource Report Resource Website 1+ mentions |
RRID:Addgene_190174 | SLC6A4 Serotonin Transporter | Rattus norvegicus | Ampicillin | PMID:17698848 | Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA 3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | changed Cys109 to alanine, changed tyr107 to cysteine | 2026-08-15 01:24:33 | 1 | |
|
pEGFP-C1-3x-NLS-mScarlet-AMPKα2 Resource Report Resource Website |
RRID:Addgene_192452 | 3x-NLS-mScarlet-AMPKalpha2 | Rattus norvegicus | Kanamycin | PMID:35790710 | Backbone Size:3994; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:24:33 | 0 | ||
|
mCherry-7aa-cb5-pEGFP-C1 Resource Report Resource Website |
RRID:Addgene_177407 | Cb5 tail anchor | Rattus norvegicus | Kanamycin | Transfection of this plasmid will express mCherry-fused to the N-terminus of Cb5 tail anchor sequence" "ITTVESNSSWWTNWVIPAISALVVALMYRLYMAED", which targets the cytoplasmic face of endoplasmic reticulum. There is a flexible, 7 aa linker "SGLRSGK", between mCherry and Cb5. | Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:24:38 | 0 | ||
|
MUNC13-1 MUN Resource Report Resource Website |
RRID:Addgene_218889 | MUNC13-1 MUN domain | Rattus norvegicus | Ampicillin | PMID:38956381 | Vector Backbone:pTEV; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:30:40 | 0 | ||
|
pCAG-2dV-Camui (T286A) Resource Report Resource Website |
RRID:Addgene_220367 | mVenus(Y145W)-mVenus(Y145W)-rat CaMK2 alpha(T286A)-mEGFP(A206K) | Rattus norvegicus | Ampicillin | PMID:39385027 | Please visit https://www.biorxiv.org/content/10.1101/2023.08.01.549180v1.full.pdf for bioRxiv preprint. | Backbone Size:4758; Vector Backbone:pCAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | changed Threonine 286 to Alanine | 2026-08-15 01:30:50 | 0 |
|
pCAG-2dV-Camui (T305D/T306D) Resource Report Resource Website |
RRID:Addgene_220368 | mVenus(Y145W)-mVenus(Y145W)-rat CaMK2 alpha(T305D/T306D)-mEGFP(A206K) | Rattus norvegicus | Ampicillin | PMID:39385027 | Please visit https://www.biorxiv.org/content/10.1101/2023.08.01.549180v1.full.pdf for bioRxiv preprint. | Backbone Size:4758; Vector Backbone:pCAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | changed both Threonine 305 and 306 to aspartic acid | 2026-08-15 01:30:50 | 0 |
|
FUGW-RUSH-LAMP1-mScarleti Resource Report Resource Website |
RRID:Addgene_228526 | LAMP1 | Rattus norvegicus | Ampicillin | PMID:40016183 | Please visit https://doi.org/10.1101/2024.05.16.594502 for bioRxiv preprint. | Backbone Size:10726; Vector Backbone:FUWG-RUSH-Strep-KDEL; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:32:01 | 0 | |
|
pAAV-Rat SARE-Arc Min Promoter-Flag Arc-Arc Genomic 3'UTR Resource Report Resource Website |
RRID:Addgene_233056 | Rat Arc | Rattus norvegicus | Ampicillin | Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin | 2026-08-15 01:32:21 | 0 | |||
|
mRFP-LAP2β Resource Report Resource Website |
RRID:Addgene_228029 | LAP2b | Rattus norvegicus | Ampicillin | PMID:37098350 | Vector Backbone:n/a; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:31:23 | 0 | ||
|
pLV-RnSyt1-sgRNA3-dCas9-KRAB-TagBFP2 (Identifier AAAA-0247) Resource Report Resource Website |
RRID:Addgene_202556 | CRISPRi single guide RNA sequence against 5’-UTR of rat synaptotagmin-1 (Syt1) gene (insert 5’ - CACCTCCTCCTGCAGCGGCAGCATCGG) | Rattus norvegicus | Ampicillin | PMID:37226896 | Backbone Marker:Dr Konstantin Kogan; Backbone Size:14900; Vector Backbone:pLV-hUV6-sgRNA-dCas9-KRAB-TagBFP; Vector Types:Lentiviral, CRISPR; Bacterial Resistance:Ampicillin | 2026-08-15 01:31:29 | 0 | ||
|
macroH2A1.2-GFP (pc2189) Resource Report Resource Website |
RRID:Addgene_223708 | macroH2A1.2-GFP | Rattus norvegicus | Kanamycin | PMID:39189450 | Backbone Size:4733; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:30:56 | 0 | ||
|
pX552-hsyn DIO GCaMP8f(with gRNA scaffold) Resource Report Resource Website 1+ mentions |
RRID:Addgene_199580 | His-DIO GCaMP8f | Rattus norvegicus | Ampicillin | PMID:38871457 | pX552 was a gift from Feng Zhang (Addgene plasmid # 60958 ; http://n2t.net/addgene:60958 ; RRID:Addgene_60958) | Backbone Size:4699; Vector Backbone:pX552; Vector Types:Mammalian Expression, AAV, Cre/Lox, CRISPR; Bacterial Resistance:Ampicillin | 2026-08-15 01:31:07 | 1 | |
|
pMRX-IPU-SNAP-Omp25 Resource Report Resource Website |
RRID:Addgene_228137 | Omp25 | Rattus norvegicus | Ampicillin | PMID:39288101 | Backbone Size:6101; Vector Backbone:pMRX-IPU; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | transmembrane region (C-terminus) | 2026-08-15 01:31:19 | 0 | |
|
pAAV-CMV-Flag-Rat Arc-Arc- Genomic 3'UTR Resource Report Resource Website |
RRID:Addgene_233053 | Rat Arc | Rattus norvegicus | Ampicillin | Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin | 2026-08-15 01:32:03 | 0 | |||
|
pAIP4_1EYH Resource Report Resource Website |
RRID:Addgene_234159 | 1EYH | Rattus norvegicus | Kanamycin | PMID:42555168 | 5' cloning site: BsaI (destroyed), 3' cloning site: BsaI (destroyed) | Backbone Size:5679; Vector Backbone:pET29b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:32:05 | 0 | |
|
pET28-NFMshuf1 Resource Report Resource Website |
RRID:Addgene_232058 | Neurofilament-Medium tail domain, charge shuffle 1 | Rattus norvegicus | Kanamycin | PMID:39602260 | Backbone Size:5200; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:32:03 | 0 | ||
|
pET28-NFHtail Resource Report Resource Website |
RRID:Addgene_232057 | Neurofilament-Heavy tail domain | Rattus norvegicus | Kanamycin | PMID:39602260 | Backbone Size:5200; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | added N-terminal tryptophan and tyrosine, and cysteine for surface grafting | 2026-08-15 01:32:04 | 0 | |
|
pET28-NFMtail Resource Report Resource Website |
RRID:Addgene_232056 | Neurofilament-Medium tail domain | Rattus norvegicus | Kanamycin | PMID:39602260 | Backbone Size:5200; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | cDNA codon-optimized for E. coli; added N-terminal tryptophan and tyrosine, and cysteine for surface grafting | 2026-08-15 01:32:03 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.