Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: SARS-CoV-2
Genetic Insert: Nsp16-HF
Vector Backbone Description: Backbone Marker:Thermo Fisher; Vector Backbone:pcDNA5-FRT-TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33313418
Proper citation: RRID:Addgene_157725 Copy
Species: SARS-CoV-2
Genetic Insert: FH-Nsp16
Vector Backbone Description: Backbone Marker:Thermo Fisher; Vector Backbone:pcDNA5-FRT-TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33313418
Proper citation: RRID:Addgene_157724 Copy
Species: SARS-CoV-2
Genetic Insert: FH-Nsp15
Vector Backbone Description: Backbone Marker:Thermo Fisher; Vector Backbone:pcDNA5-FRT-TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33313418
Proper citation: RRID:Addgene_157721 Copy
Species: SARS-CoV-2
Genetic Insert: Nsp15
Vector Backbone Description: Backbone Marker:Thermo Fisher; Vector Backbone:pcDNA5-FRT-TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33313418
Proper citation: RRID:Addgene_157720 Copy
Species: SARS-CoV-2
Genetic Insert: Nprot_GC3opt
Vector Backbone Description: Backbone Marker:Thermo Fisher; Vector Backbone:pcDNA5-FRT-TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33313418
Proper citation: RRID:Addgene_157730 Copy
Species: SARS-CoV-2
Genetic Insert: Nprot-HF_GC3opt
Vector Backbone Description: Backbone Marker:Thermo Fisher; Vector Backbone:pcDNA5-FRT-TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33313418
Proper citation: RRID:Addgene_157732 Copy
Species: SARS-CoV-2
Genetic Insert: N
Vector Backbone Description: Vector Backbone:pTHMT; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33200826
Proper citation: RRID:Addgene_157869 Copy
Species: SARS-CoV-2
Genetic Insert: N
Vector Backbone Description: Vector Backbone:pTHMT; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33200826
Comments: Please note: This plasmid contains a D15H mutation in MBP. This mutation is not known to affect plasmid function.
Proper citation: RRID:Addgene_157872 Copy
Species: SARS-CoV-2
Genetic Insert: N
Vector Backbone Description: Vector Backbone:pTHMT; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33200826
Proper citation: RRID:Addgene_157871 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 S ectodomain
Vector Backbone Description: Backbone Marker:Joachim Messing; Vector Backbone:Plasmid 50005: pUC19; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34416153
Proper citation: RRID:Addgene_157972 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 S ectodomain
Vector Backbone Description: Backbone Marker:Joachim Messing; Vector Backbone:Plasmid 50005: pUC19; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34416153
Proper citation: RRID:Addgene_157971 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF6
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)FHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID - UniProtKB - P0DTC6 (NS6_SARS2)
Proper citation: RRID:Addgene_162817 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_9b
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)DPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK - UniProtKB - P0DTD2 (ORF9B_SARS2)
Proper citation: RRID:Addgene_162816 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF3b_alt
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Alternative ORF3b as described in Hachim et. al., 2020, (doi:10.1038/s41590-020-0773-7) - Protein sequence: (TAG)AYCWRCTSCCFSERFQNHNPQKEMATSTLQGCSLCLQLAVVVCNSLLTPFARCCWP
Proper citation: RRID:Addgene_162821 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 RBD
Vector Backbone Description: Backbone Marker:Eric Kowarz; Backbone Size:6625; Vector Backbone:pSBbi-RP (Addgene Plasmid #60513); Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36619904
Comments: The SARS-CoV-2 RBD insert was designed by Jorge L. Arias-Arias from Universidad de Costa Rica ([email protected]).
This vector is suitable for transient transfection, but it was intended to be co-transfected with the transposase vector pCMV(CAT)T7-SB100 (Addgene Plasmid #34879) in order to generate stable mammalian cells for the production of SARS-CoV-2 RBD protein. This protein can be recovered from the cell culture medium by His-tag purification.
The recombinant RBD is suitable for COVID-19 serology testing and monitoring of humoral responses in vaccinated population.
Proper citation: RRID:Addgene_161793 Copy
Species: SARS-CoV-2
Genetic Insert: 3CL Protease
Vector Backbone Description: Vector Backbone:pLEX_307; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33910954
Comments: This plasmid is stored and distributed in NEB Stable. It can also be used to transform NEB 10Beta.
The authors have noticed that there are high rates of recombination in these generated vectors. All users are advised to sequence the vectors and run them on a gel to ensure they show the expected full length insert and plasmid size. In cases where recombination has occurred it is typically between the viral LTR elements in the vector although recombination between the gateway cloning sites has also been observed.
Please visit https://doi.org/10.1101/2020.08.29.272864 for bioRxiv preprint.
Proper citation: RRID:Addgene_160278 Copy
Species: SARS-CoV-2
Genetic Insert: 3CL Protease
Vector Backbone Description: Vector Backbone:pLEX_307; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33910954
Comments: This plasmid is stored and distributed in NEB Stable. It can also be used to transform NEB 10Beta.
The authors have noticed that there are high rates of recombination in these generated vectors. All users are advised to sequence the vectors and run them on a gel to ensure they show the expected full length insert and plasmid size. In cases where recombination has occurred it is typically between the viral LTR elements in the vector although recombination between the gateway cloning sites has also been observed.
Please visit https://doi.org/10.1101/2020.08.29.272864 for bioRxiv preprint.
Proper citation: RRID:Addgene_160279 Copy
Species: SARS-CoV-2
Genetic Insert: NSP12
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:3000; Vector Backbone:pRSFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32783916
Comments: Please visit https://doi.org/10.1101/2020.07.08.194084 for bioRxiv preprint.
Proper citation: RRID:Addgene_159107 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 S protein
Vector Backbone Description: Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33243994
Comments: Pseudotypes to the MLV vector but not efficiently to VSV or lentiviral vectors.
Please visit https://www.biorxiv.org/content/10.1101/2020.06.12.148726v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_159363 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2-nsp1
Vector Backbone Description: Backbone Marker:Takara Bio; Backbone Size:8825; Vector Backbone:pLVX-EF1alpha-IRES-Puro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32353859
Comments: Please visit https://www.biorxiv.org/content/10.1101/2020.03.22.002386v3 for bioRxiv preprint.
Proper citation: RRID:Addgene_141367 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
