Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: E. coli
Genetic Insert: SCRIBE_galK(ON)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZA21; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61451 Copy
Species: E. coli
Genetic Insert: msd_kanR(ON)_dRT
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61452 Copy
Species: E. coli
Genetic Insert: msd(wt)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61453 Copy
Species: E. coli
Genetic Insert: msd_kanR(ON)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61447 Copy
Species: E. coli
Genetic Insert: SCRIBE_kanR(ON)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61448 Copy
Species: E. coli
Genetic Insert: SCRIBE_galK(OFF)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61449 Copy
Species: E. coli
Genetic Insert: CRP/CAP
Vector Backbone Description: Backbone Marker:NEB; Vector Backbone:pTXB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_51563 Copy
Species: E. coli
Genetic Insert: rnc
Vector Backbone Description: Vector Backbone:pBAD24; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23893733
Proper citation: RRID:Addgene_51560 Copy
Species: E. coli
Genetic Insert: KanR
Vector Backbone Description: Backbone Size:4361; Vector Backbone:pBR322; Vector Types:Synthetic Biology, Diatom Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25302562
Comments: Note: There are some small discrepancies between Addgene's quality control sequence and the assembled sequence from the depositor. They should not affect the function of the plasmid.
Proper citation: RRID:Addgene_56659 Copy
Species: E. coli
Genetic Insert: lacZ alpha
Vector Backbone Description: Vector Backbone:pEGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_61971 Copy
Species: E. coli
Genetic Insert: MG1655-tMMR
Vector Backbone Description: Vector Backbone:genomic; Vector Types:; Bacterial Resistance:Tetracycline
Defining Citation: PMID:24500200
Comments: For detailed use and MAGE, see:
1. Nyerges, Á. et al. Conditional DNA repair mutants enable highly precise genome engineering. Nucl. Acids Res. 42, e62–e62 (2014).
2. Gallagher, R. R., Li, Z., Lewis, A. O. & Isaacs, F. J. Rapid editing and evolution of bacterial genomes using libraries of synthetic DNA. Nat. Protocols 9, 2301–2316 (2014).
3. Bonde, M. T., Anderson, M. V., Wallin, A. I. N., Wang, H. H. & Sommer, M. O. A. MODEST: a web-based design tool for oligonucleotide-mediated genome engineering and recombineering. Nucl. Acids Res. (2014). doi:10.1093/nar/gku428
Proper citation: RRID:Addgene_62392 Copy
Species: E. coli
Genetic Insert: OmpA
Vector Backbone Description: Backbone Marker:DNA2.0; Backbone Size:4000; Vector Backbone:pJexpress414; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26199411
Comments: AA sequence: MKKTAIAIAVALAGFATVAQAAPNDNTWYTGAKLGWSQYHDTGFI
NNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLG
YPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWT
NNIGDYPYDVPDYATRPDNGMLSLGVSYRFGCCPGCCHHHHHH
Proper citation: RRID:Addgene_62646 Copy
Species: E. coli
Genetic Insert: ykgMO-IGS
Vector Backbone Description: Backbone Marker:p15A ori plasmid; Backbone Size:4770; Vector Backbone:pJBL5034; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:37523538
Proper citation: RRID:Addgene_207231 Copy
Species: E. coli
Genetic Insert: ykgMO-IGS
Vector Backbone Description: Backbone Marker:p15A ori plasmid; Backbone Size:2269; Vector Backbone:pJBL5034; Vector Types:Bacterial Expression, Luciferase, Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:37523538
Proper citation: RRID:Addgene_207232 Copy
Species: E. coli
Genetic Insert: Enzyme BirA
Vector Backbone Description: Vector Backbone:pGEX-2T; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9887208
Proper citation: RRID:Addgene_209131 Copy
Species: E. coli
Genetic Insert: BirA_Ecoli
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26099); Vector Backbone:pFBOH-LIC edited; Vector Types:Baculovirus expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37390814
Comments: SGC ID: BirA_Ecoli:TOC025-E08:C244778
Please visit https://www.biorxiv.org/content/10.1101/2022.11.21.516512v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_196581 Copy
Species: E. coli
Genetic Insert: FtsZ
Vector Backbone Description: Vector Backbone:pDR175; Vector Types:Bacterial Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:25848771
Proper citation: RRID:Addgene_98913 Copy
Species: E. coli
Genetic Insert: FtsZ
Vector Backbone Description: Vector Backbone:pCA24N; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25848771
Proper citation: RRID:Addgene_98914 Copy
Species: E. coli
Genetic Insert: NarX
Vector Backbone Description: Backbone Marker:Gift from Tabor lab; Vector Backbone:pJL; Vector Types:Bacterial Expression, Cell free expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37126679
Proper citation: RRID:Addgene_225651 Copy
Species: E. coli
Genetic Insert: CspRecT, mutL_E32K, E. coli SSB
Vector Backbone Description: Vector Backbone:pORTMAGE-Ec1; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:39237706
Proper citation: RRID:Addgene_227187 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
