Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Rattus norvegicus
Genetic Insert: 3x-NLS-mScarlet-AMPKalpha2
Vector Backbone Description: Backbone Size:3994; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35790710
Proper citation: RRID:Addgene_192452 Copy
Species: Rattus norvegicus
Genetic Insert: Cb5 tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: Transfection of this plasmid will express mCherry-fused to the N-terminus of Cb5 tail anchor sequence" "ITTVESNSSWWTNWVIPAISALVVALMYRLYMAED", which targets the cytoplasmic face of endoplasmic reticulum. There is a flexible, 7 aa linker "SGLRSGK", between mCherry and Cb5.
Proper citation: RRID:Addgene_177407 Copy
Species: Rattus norvegicus
Genetic Insert: EGFP-Synaptobrevin-2, P2A, Palm-tdTomato (tdTomato with Palmitoylation sequence)
Vector Backbone Description: Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37426757
Proper citation: RRID:Addgene_210729 Copy
Species: Rattus norvegicus
Genetic Insert: F-tractin
Vector Backbone Description: Backbone Marker:Thermo Fisher; Backbone Size:900; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38036853
Comments: Please visit https://doi.org/10.21203/rs.3.rs-2941917/v1 for ResearchSquare preprint.
Proper citation: RRID:Addgene_212019 Copy
Species: Rattus norvegicus
Genetic Insert: Galpha-oA ONE-GO
Vector Backbone Description: Vector Backbone:pLVX-IRES-Hygro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38412860
Proper citation: RRID:Addgene_189732 Copy
Species: Rattus norvegicus
Genetic Insert: Galpha-oB ONE-GO
Vector Backbone Description: Vector Backbone:pLVX-IRES-Hygro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38412860
Proper citation: RRID:Addgene_189733 Copy
Species: Rattus norvegicus
Genetic Insert: Galpha-i3 ONE-GO
Vector Backbone Description: Vector Backbone:pLVX-IRES-Hygro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38412860
Proper citation: RRID:Addgene_189737 Copy
Species: Rattus norvegicus
Genetic Insert: Galpha-i3 G183S ONE-GO
Vector Backbone Description: Vector Backbone:pLVX-IRES-Hygro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38412860
Proper citation: RRID:Addgene_204338 Copy
Species: Rattus norvegicus
Genetic Insert: hSyn Galpha-i3 ONE-GO
Vector Backbone Description: Vector Backbone:pLVX-IRES-Hygro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38412860
Proper citation: RRID:Addgene_204334 Copy
Species: Rattus norvegicus
Genetic Insert: hSyn Galpha-oA ONE-GO
Vector Backbone Description: Vector Backbone:pLVX-IRES-Hygro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38412860
Proper citation: RRID:Addgene_204335 Copy
Species: Rattus norvegicus
Genetic Insert: hSyn Galpha-i1 ONE-GO
Vector Backbone Description: Vector Backbone:pLVX-IRES-Hygro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38412860
Proper citation: RRID:Addgene_204333 Copy
Species: Rattus norvegicus
Genetic Insert: SV40 Galpha-i3 ONE-GO
Vector Backbone Description: Vector Backbone:pLVX-IRES-Hygro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38412860
Proper citation: RRID:Addgene_204329 Copy
Species: Rattus norvegicus
Genetic Insert: BCAR1
Vector Backbone Description: Backbone Size:4856; Vector Backbone:pFastBac Htb; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35049497
Proper citation: RRID:Addgene_186131 Copy
Species: Rattus norvegicus
Genetic Insert: GCaMP6f
Vector Backbone Description: Backbone Size:5080; Vector Backbone:pAAV-TetO(3G)-WPRE; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35798979
Comments: Please visit https://www.biorxiv.org/content/10.1101/2020.10.04.325324v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_186205 Copy
Species: Rattus norvegicus
Genetic Insert: LAMP1
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pmCherry-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33237838
Proper citation: RRID:Addgene_164477 Copy
Species: Rattus norvegicus
Genetic Insert: Synapsin1a
Vector Backbone Description: Backbone Marker:Clontech, Palo Alto, California; Backbone Size:3998; Vector Backbone:pEGFP-C1 vector; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: F255Y and S304A mutations in Synapsin1a insert do not affect plasmid function.
Proper citation: RRID:Addgene_187896 Copy
Species: Rattus norvegicus
Genetic Insert: rat KIF5C
Vector Backbone Description: Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35504282
Proper citation: RRID:Addgene_188071 Copy
Species: Rattus norvegicus
Genetic Insert: rat KIF5C
Vector Backbone Description: Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35504282
Proper citation: RRID:Addgene_188072 Copy
Species: Rattus norvegicus
Genetic Insert: cacna1a
Vector Backbone Description: Backbone Marker:Invitrogen Life Technologies; Backbone Size:5446; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31577951
Proper citation: RRID:Addgene_206121 Copy
Species: Rattus norvegicus
Genetic Insert: Syt9
Vector Backbone Description: Backbone Marker:David Baltimore (Addgene plasmid # 14883); Vector Backbone:FUGW; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36732068
Comments: Bovine preprolactin signal sequence precedes the N-terminal pHluorin tag; bicistronic mRuby3 expression.
Please visit https://www.biorxiv.org/content/10.1101/2022.04.18.488681v2 for bioRxiv preprint.
Proper citation: RRID:Addgene_195698 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
