Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Mus musculus
Genetic Insert: HybridB-IRES-tauLacZ LNL TV
Vector Backbone Description: Backbone Size:3000; Vector Backbone:pBS; Vector Types:high copy number; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15186781
Comments: The mouse strain that was derived from this plasmid is available from The Jackson Laboratory: http://jaxmice.jax.org/strain/006629.html
Proper citation: RRID:Addgene_15652 Copy
Species: Rattus norvegicus
Genetic Insert: rApoI
Vector Backbone Description: Vector Backbone:None; Vector Types:; Bacterial Resistance:Streptomycin
Defining Citation: PMID:29991261
Comments: Esherichia coli strain that expresses MutaT7, a fusion of rat APOBEC1 and the T7 RNA polymerase. Genotype: DH10B Δung ΔmotAB ΔcsgABCDEFG [PlacI<>Ptac] Δ(araA-leu)7697::[PA1lacO-Tenth MutaT7]
Proper citation: RRID:Addgene_156460 Copy
Species: Mus musculus
Genetic Insert: Intercellular Adhesion Molecule 1
Vector Backbone Description: Backbone Marker:Invivogen; Backbone Size:4179; Vector Backbone:pFUSE; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:32783949
Comments: Depositor confirms P66S and L234P mutations does not affect plasmid function.
Proper citation: RRID:Addgene_156462 Copy
Species: Mus musculus
Genetic Insert: Rab38
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:6400; Vector Backbone:pcDNA-DEST53 Gateway; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:11917121
Proper citation: RRID:Addgene_15669 Copy
Species: Homo sapiens
Genetic Insert: USP28 shRNA
Vector Backbone Description: Backbone Size:6400; Vector Backbone:pRetrosuper; Vector Types:Mammalian Expression, Retroviral, RNAi; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17558397
Comments: hairpin targets the sequence: GTATGGACAAGAGCGTTGGT
Proper citation: RRID:Addgene_15664 Copy
Species: Homo sapiens
Genetic Insert: USP28 shRNA
Vector Backbone Description: Backbone Size:6400; Vector Backbone:pRetrosuper; Vector Types:Mammalian Expression, Retroviral, RNAi; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17558397
Comments: Hairpin targets the sequence: GGAGTGAGATTGAACAAGA.
Proper citation: RRID:Addgene_15663 Copy
Species: Homo sapiens
Genetic Insert: Myc shRNA
Vector Backbone Description: Backbone Size:6400; Vector Backbone:pRetrosuper; Vector Types:Mammalian Expression, Retroviral, RNAi; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17558397
Comments: hairpin targets the sequence: GATGAGGAAGAAATCGATG
Proper citation: RRID:Addgene_15662 Copy
Species: Synthetic
Genetic Insert: Nsp10
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNGFAVx
Proper citation: RRID:Addgene_156479 Copy
Species: Synthetic
Genetic Insert: Nsp7
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQx
Proper citation: RRID:Addgene_156476 Copy
Species: Synthetic
Genetic Insert: Nsp9
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQx
Proper citation: RRID:Addgene_156478 Copy
Species: Synthetic
Genetic Insert: Nsp8
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQx
Proper citation: RRID:Addgene_156477 Copy
Species: Synthetic
Genetic Insert: Nsp3c_SUD-C
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: MDSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLR
Proper citation: RRID:Addgene_156471 Copy
Species: Synthetic
Genetic Insert: Nsp3e_NAB
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETx
Proper citation: RRID:Addgene_156473 Copy
Species: Homo sapiens
Genetic Insert: p15 4xSBR2
Vector Backbone Description: Backbone Size:5600; Vector Backbone:pGL2-E1bTATA; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16959612
Comments: SBR2 is one of the Smad Binding Regions on the p15INK4b promoter
Proper citation: RRID:Addgene_15708 Copy
Species: Synthetic
Genetic Insert: Nsp15
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GLQSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLx
Proper citation: RRID:Addgene_156481 Copy
Species: Mus musculus
Genetic Insert: M71->P2-IRES-tauLacZ LNL 129 TV
Vector Backbone Description: Backbone Size:3000; Vector Backbone:pBS; Vector Types:high copy number; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15186781
Proper citation: RRID:Addgene_15647 Copy
Species: Homo sapiens
Genetic Insert: TIF1 gamma
Vector Backbone Description: Backbone Marker:Amersham; Backbone Size:4969; Vector Backbone:pGEX-4T1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16751102
Proper citation: RRID:Addgene_15734 Copy
Species: Homo sapiens
Genetic Insert: Smad2 (L+MH2)
Vector Backbone Description: Backbone Marker:Amersham; Backbone Size:4969; Vector Backbone:pGEX-4T1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16751102
Proper citation: RRID:Addgene_15730 Copy
Species: Mus musculus
Genetic Insert: p110 delta
Vector Backbone Description: Backbone Size:6800; Vector Backbone:pPyCAG-IP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12774123
Proper citation: RRID:Addgene_15691 Copy
Species: Homo sapiens
Genetic Insert: Fibroblast growth factor 2
Vector Backbone Description: Backbone Size:5369; Vector Backbone:pHis; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32383752
Proper citation: RRID:Addgene_157657 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
