Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Arabidopsis thaliana
Genetic Insert: PAL2
Vector Backbone Description: Backbone Size:2999; Vector Backbone:pSTV28; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:21722749
Comments: *Note: Addgene's quality control sequencing finds an E50A amino acid residue substitution in the A. thaliana PAL2 gene insert. The depositing laboratory does not believe this residue change will affect protein function. This plasmid accurately reflects the construct as it was used in the associated publication.
Proper citation: RRID:Addgene_78286 Copy
Species: Arabidopsis thaliana
Genetic Insert: SD3(1-50)
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:11124; Vector Backbone:pMpGWB106; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:23421791
Proper citation: RRID:Addgene_79135 Copy
Species: Arabidopsis thaliana
Genetic Insert: PIF6-DBD
Vector Backbone Description: Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29301067
Comments: Plasmid contains amino acids 1-100 of PIF6 [NCBI NP_001327149.1].
Proper citation: RRID:Addgene_90511 Copy
Species: Arabidopsis thaliana
Genetic Insert: VP64-PIF3
Vector Backbone Description: Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29301067
Proper citation: RRID:Addgene_90498 Copy
Species: Arabidopsis thaliana
Genetic Insert: PhyB NT-MTAD
Vector Backbone Description: Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29301067
Proper citation: RRID:Addgene_90496 Copy
Species: Arabidopsis thaliana
Genetic Insert: Cry2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24920824
Proper citation: RRID:Addgene_64208 Copy
Species: Arabidopsis thaliana
Genetic Insert: Cry2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24920824
Proper citation: RRID:Addgene_64207 Copy
Species: Arabidopsis thaliana
Genetic Insert: Cry2 PHR
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24920824
Comments: PGK1 is cloned within the KpnI and XbaI sites
Proper citation: RRID:Addgene_64214 Copy
Species: Arabidopsis thaliana
Genetic Insert: CUC2
Vector Backbone Description: Vector Backbone:pGADT7; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25448000
Proper citation: RRID:Addgene_64805 Copy
Species: Arabidopsis thaliana
Genetic Insert: TCP4
Vector Backbone Description: Vector Backbone:pGADT7; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25448000
Proper citation: RRID:Addgene_64807 Copy
Species: Arabidopsis thaliana
Genetic Insert: CUC2
Vector Backbone Description: Vector Backbone:pGBKT7; Vector Types:; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25448000
Proper citation: RRID:Addgene_64808 Copy
Species: Arabidopsis thaliana
Genetic Insert: SPL9
Vector Backbone Description: Vector Backbone:pYES-DEST52; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25448000
Proper citation: RRID:Addgene_64811 Copy
Species: Arabidopsis thaliana
Genetic Insert: CUC3
Vector Backbone Description: Vector Backbone:JW772 (pCAMBIA2300); Vector Types:; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25448000
Proper citation: RRID:Addgene_64818 Copy
Species: Arabidopsis thaliana
Genetic Insert: CUC2
Vector Backbone Description: Vector Backbone:JW771 (pCAMBIA2300); Vector Types:; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25448000
Proper citation: RRID:Addgene_64817 Copy
Species: Arabidopsis thaliana
Genetic Insert: PRORP1
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:22976545
Comments: The mitochondrial targeting sequence “MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPRF“ of native precursor PRORP1 was replaced with the dipeptide “MG”
Proper citation: RRID:Addgene_67869 Copy
Species: Arabidopsis thaliana
Genetic Insert: PIAL2
Vector Backbone Description: Backbone Marker:NEB; Backbone Size:6700; Vector Backbone:pMAL-c2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25415977
Proper citation: RRID:Addgene_67909 Copy
Species: Arabidopsis thaliana
Genetic Insert: Cold temperature germinating 10 (CTG10)
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:6494; Vector Backbone:pBD-GAL4 Cam; Vector Types:Yeast Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29632208
Proper citation: RRID:Addgene_67911 Copy
Species: Arabidopsis thaliana
Genetic Insert: PRORP2
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:22976545
Proper citation: RRID:Addgene_67870 Copy
Species: Arabidopsis thaliana
Genetic Insert: Promoter_AtU6-26 + sgRNA_BolC.GA4a-2
Vector Backbone Description: Vector Backbone:pICH47761 (AddGene #48003); Vector Types:Plant Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26616834
Comments: Target sequence: GTTGAGAGGGGAGCCGGTGA
Proper citation: RRID:Addgene_68256 Copy
Species: Arabidopsis thaliana
Genetic Insert: Promoter: U6-26 (Arabidopsis thaliana)
Vector Backbone Description: Vector Backbone:pAGM9121; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:26616834
Proper citation: RRID:Addgene_68261 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
