Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: TCERG1 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - AGATAVSEWTEYKTADGKTYYYNNRTLESTWEKPQELKE
Proper citation: RRID:Addgene_104240 Copy
Species: Homo sapiens
Genetic Insert: MAGI1 WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - NLGPLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNK
Proper citation: RRID:Addgene_104242 Copy
Species: Homo sapiens
Genetic Insert: APBB2 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - TDPDLPPGWKRVSDIAGTYYWHIPTGTTQWERPVSIPAD
Proper citation: RRID:Addgene_104257 Copy
Species: Homo sapiens
Genetic Insert: WBP4 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - KKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDDFIP
Proper citation: RRID:Addgene_104253 Copy
Species: Homo sapiens
Genetic Insert: PLEKHA5 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - QSTDLPTGWEEAYTFEGARYYINHNERKVTCKHPVTGQP
Proper citation: RRID:Addgene_104259 Copy
Species: Homo sapiens
Genetic Insert: WWP1 WW domain #3
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQGL
Proper citation: RRID:Addgene_104222 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: FBP1
Vector Backbone Description: Backbone Size:8017; Vector Backbone:pJO629; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28126757
Comments: Replace the Yap5 gene of pJO629 to FBP1 gene.
Proper citation: RRID:Addgene_104343 Copy
Species: Homo sapiens
Genetic Insert: WWP1 WW domain #4
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - NEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKS
Proper citation: RRID:Addgene_104223 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: TUP1
Vector Backbone Description: Backbone Size:4887; Vector Backbone:pRS316; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18708352
Proper citation: RRID:Addgene_104341 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SSN6
Vector Backbone Description: Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18708352
Comments: Addgene NGS result found SSN6 with P40Q variant.
Proper citation: RRID:Addgene_104340 Copy
Species: Homo sapiens
Genetic Insert: KIBRA WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PELPLPEGWEEARDFDGKVYYIDHTNRTTSWIDPRDRYT
Proper citation: RRID:Addgene_104229 Copy
Species: Homo sapiens
Genetic Insert: SMURF2 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - TPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRD
Proper citation: RRID:Addgene_104225 Copy
Species: Homo sapiens
Genetic Insert: YAP1 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - ASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPR
Proper citation: RRID:Addgene_104228 Copy
Species: Homo sapiens
Genetic Insert: FNBP3 WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - TASGAKSMWTEHKSPDGRTYYYNTETKQSTWEKPDDLKT
Proper citation: RRID:Addgene_104233 Copy
Species: Homo sapiens
Genetic Insert: HYPC WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - ELLLSQCPWKEYKSDTGKPYYYNNQSKESRWTRPKDLDD
Proper citation: RRID:Addgene_104232 Copy
Species: Homo sapiens
Genetic Insert: WWOX WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - SEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKR
Proper citation: RRID:Addgene_104235 Copy
Species: Homo sapiens
Genetic Insert: FNBP3 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - EQLLSKCPWKEYKSDSGKPYYYNSQTKESRWAKPKELED
Proper citation: RRID:Addgene_104234 Copy
Species: Homo sapiens
Genetic Insert: SMURF1 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - ELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHI
Proper citation: RRID:Addgene_104238 Copy
Species: Homo sapiens
Genetic Insert: BHMT
Vector Backbone Description: Backbone Size:4754; Vector Backbone:pRK5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18059170
Comments: GFP is from Aequorea victoria
Proper citation: RRID:Addgene_104442 Copy
Species: Arabidopsis thaliana
Genetic Insert: sgRNA-transRNA transcription by U6 promoter
Vector Backbone Description: Backbone Marker:Lampropoulos et al., 2013; Vector Backbone:pE000; Vector Types:Bacterial Expression, Plant Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30083222
Proper citation: RRID:Addgene_104441 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.