Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: SARS-CoV-2
Genetic Insert: nsp10, nsp16
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33423577
Comments: SGC clone sample ID: nsp16_SARS2-nsp10_SARS2-MVC019-A07:C245477
Proper citation: RRID:Addgene_167849 Copy
Species: SARS-CoV-2
Genetic Insert: 3CL Protease
Vector Backbone Description: Vector Backbone:pLEX_307; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33910954
Comments: This plasmid is stored and distributed in NEB Stable. It can also be used to transform NEB 10Beta.
The authors have noticed that there are high rates of recombination in these generated vectors. All users are advised to sequence the vectors and run them on a gel to ensure they show the expected full length insert and plasmid size. In cases where recombination has occurred it is typically between the viral LTR elements in the vector although recombination between the gateway cloning sites has also been observed.
Please visit https://doi.org/10.1101/2020.08.29.272864 for bioRxiv preprint.
Proper citation: RRID:Addgene_160278 Copy
Species: SARS-CoV-2
Genetic Insert: 3CL Protease
Vector Backbone Description: Vector Backbone:pLEX_307; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33910954
Comments: This plasmid is stored and distributed in NEB Stable. It can also be used to transform NEB 10Beta.
The authors have noticed that there are high rates of recombination in these generated vectors. All users are advised to sequence the vectors and run them on a gel to ensure they show the expected full length insert and plasmid size. In cases where recombination has occurred it is typically between the viral LTR elements in the vector although recombination between the gateway cloning sites has also been observed.
Please visit https://doi.org/10.1101/2020.08.29.272864 for bioRxiv preprint.
Proper citation: RRID:Addgene_160279 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 Nucleocapsid phosphoprotein
Vector Backbone Description: Backbone Size:6502; Vector Backbone:MscV-IRES-mcherry; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34257311
Comments: Fareh lab cloned this construct for this study (BioRxiv--Reprogrammed CRISPR-Cas13b suppresses SARS-CoV-2 replication and circumvents its mutational escape through mismatch tolerance)
Proper citation: RRID:Addgene_173030 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 Spike protein
Vector Backbone Description: Backbone Marker:Thermo Fisher; Backbone Size:2900; Vector Backbone:pRSET5A; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol and Ampicillin
Defining Citation: PMID:35123472
Proper citation: RRID:Addgene_171709 Copy
Species: SARS-CoV-2
Genetic Insert: Spike of B.1.617.1 strain
Vector Backbone Description: Backbone Size:5500; Vector Backbone:pcDNA3.3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34519517
Proper citation: RRID:Addgene_172319 Copy
Species: SARS-CoV-2
Genetic Insert: Spike of B.1.617.2 strain
Vector Backbone Description: Backbone Size:5500; Vector Backbone:pcDNA3.3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34519517
Proper citation: RRID:Addgene_172320 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 Spike
Vector Backbone Description: Backbone Marker:Vectorbuilder; Vector Backbone:pRP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: Codon-optimized SARS-CoV-2 Spike was cloned from SinoBiological plasmid VG40589-UT. An 18-amino acid truncation was introduced to improve expression. The plasmid can be used to generate Spike-pseudotyped lentiviral or VSV particles.
Proper citation: RRID:Addgene_164583 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 RBD
Vector Backbone Description: Backbone Marker:Eric Kowarz; Backbone Size:6625; Vector Backbone:pSBbi-RP (Addgene Plasmid #60513); Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36619904
Comments: The SARS-CoV-2 RBD insert was designed by Jorge L. Arias-Arias from Universidad de Costa Rica ([email protected]).
This vector is suitable for transient transfection, but it was intended to be co-transfected with the transposase vector pCMV(CAT)T7-SB100 (Addgene Plasmid #34879) in order to generate stable mammalian cells for the production of SARS-CoV-2 RBD protein. This protein can be recovered from the cell culture medium by His-tag purification.
The recombinant RBD is suitable for COVID-19 serology testing and monitoring of humoral responses in vaccinated population.
Proper citation: RRID:Addgene_161793 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF6
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)FHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID - UniProtKB - P0DTC6 (NS6_SARS2)
Proper citation: RRID:Addgene_162817 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_9b
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)DPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK - UniProtKB - P0DTD2 (ORF9B_SARS2)
Proper citation: RRID:Addgene_162816 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF3b_alt
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Alternative ORF3b as described in Hachim et. al., 2020, (doi:10.1038/s41590-020-0773-7) - Protein sequence: (TAG)AYCWRCTSCCFSERFQNHNPQKEMATSTLQGCSLCLQLAVVVCNSLLTPFARCCWP
Proper citation: RRID:Addgene_162821 Copy
Species: SARS-CoV-2
Genetic Insert: 6His-TEV-Nsp14
Vector Backbone Description: Backbone Size:5233; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_154954 Copy
Species: SARS-CoV-2
Genetic Insert: Strep-TEV-Nsp14
Vector Backbone Description: Backbone Size:5233; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_154955 Copy
Species: SARS-CoV-2
Genetic Insert: Nsp14-TEV-6His
Vector Backbone Description: Backbone Size:5233; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_154952 Copy
Species: SARS-CoV-2
Genetic Insert: Nsp14-TEV-Strep
Vector Backbone Description: Backbone Size:5233; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_154953 Copy
Species: SARS-CoV-2
Genetic Insert: 6His-SUMO-Nsp10
Vector Backbone Description: Backbone Size:5375; Vector Backbone:pET22; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_154960 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 3a protein (aa 42-275)
Vector Backbone Description: Backbone Marker:Geneva Biotech; Vector Backbone:Derived from pACEBAC1; Vector Types:Insect Expression; Bacterial Resistance:Gentamicin
Defining Citation: PMID:32587976
Comments: Truncation made by PCR.
Please visit https://www.biorxiv.org/lookup/doi/10.1101/2020.06.17.156554 for bioRxiv preprint.
Proper citation: RRID:Addgene_156425 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 3a protein (aa 42-275)
Vector Backbone Description: Backbone Marker:Eric Gouaux Lab; Vector Backbone:Derived from pEG BacMam; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32587976
Comments: Please visit https://www.biorxiv.org/lookup/doi/10.1101/2020.06.17.156554 for bioRxiv preprint.
Proper citation: RRID:Addgene_156426 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 3a protein
Vector Backbone Description: Backbone Marker:Eric Gouaux Lab; Vector Backbone:Derived from pEG BacMam; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32587976
Comments: Please visit https://www.biorxiv.org/lookup/doi/10.1101/2020.06.17.156554 for bioRxiv preprint.
Proper citation: RRID:Addgene_156422 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
