Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pET28-MHL: nsp16_SARS-CoV-2|nsp10_SARS-CoV-2 Resource Report Resource Website |
RRID:Addgene_167849 | nsp10, nsp16 | SARS-CoV-2 | Kanamycin | PMID:33423577 | SGC clone sample ID: nsp16_SARS2-nsp10_SARS2-MVC019-A07:C245477 | Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:47 | 0 | |
|
pLEX307-SARS-CoV-2-3CL Resource Report Resource Website 1+ mentions |
RRID:Addgene_160278 | 3CL Protease | SARS-CoV-2 | Ampicillin | PMID:33910954 | This plasmid is stored and distributed in NEB Stable. It can also be used to transform NEB 10Beta. The authors have noticed that there are high rates of recombination in these generated vectors. All users are advised to sequence the vectors and run them on a gel to ensure they show the expected full length insert and plasmid size. In cases where recombination has occurred it is typically between the viral LTR elements in the vector although recombination between the gateway cloning sites has also been observed. Please visit https://doi.org/10.1101/2020.08.29.272864 for bioRxiv preprint. | Vector Backbone:pLEX_307; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:08:40 | 3 | |
|
pLEX307-SARS-CoV-2-3CL-C145A Resource Report Resource Website |
RRID:Addgene_160279 | 3CL Protease | SARS-CoV-2 | Ampicillin | PMID:33910954 | This plasmid is stored and distributed in NEB Stable. It can also be used to transform NEB 10Beta. The authors have noticed that there are high rates of recombination in these generated vectors. All users are advised to sequence the vectors and run them on a gel to ensure they show the expected full length insert and plasmid size. In cases where recombination has occurred it is typically between the viral LTR elements in the vector although recombination between the gateway cloning sites has also been observed. Please visit https://doi.org/10.1101/2020.08.29.272864 for bioRxiv preprint. | Vector Backbone:pLEX_307; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | C145A | 2026-08-15 01:08:37 | 0 |
|
SARS-CoV-2 Nucleocapsid-3xHA-IRES-mcherry Resource Report Resource Website |
RRID:Addgene_173030 | SARS-CoV-2 Nucleocapsid phosphoprotein | SARS-CoV-2 | Ampicillin | PMID:34257311 | Fareh lab cloned this construct for this study (BioRxiv--Reprogrammed CRISPR-Cas13b suppresses SARS-CoV-2 replication and circumvents its mutational escape through mismatch tolerance) | Backbone Size:6502; Vector Backbone:MscV-IRES-mcherry; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:10:30 | 0 | |
|
CBM9-ID-H1 Resource Report Resource Website |
RRID:Addgene_171709 | SARS-CoV-2 Spike protein | SARS-CoV-2 | Chloramphenicol and Ampicillin | PMID:35123472 | Backbone Marker:Thermo Fisher; Backbone Size:2900; Vector Backbone:pRSET5A; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol and Ampicillin | 2026-08-15 01:10:20 | 0 | ||
|
pcDNA3.3-SARS2-B.1.617.1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_172319 | Spike of B.1.617.1 strain | SARS-CoV-2 | Ampicillin | PMID:34519517 | Backbone Size:5500; Vector Backbone:pcDNA3.3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | G142D, E154K, L452R, E484Q, D614G, P681R, Q1071H, H1101D, c-terminal 18aa deletion | 2026-08-15 01:10:23 | 3 | |
|
pcDNA3.3-SARS2-B.1.617.2 Resource Report Resource Website 10+ mentions |
RRID:Addgene_172320 | Spike of B.1.617.2 strain | SARS-CoV-2 | Ampicillin | PMID:34519517 | Backbone Size:5500; Vector Backbone:pcDNA3.3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | T19R, 156G, 157-158del, L452R, T478K, D614G, P681R, D950N, c-terminal 18aa deletion | 2026-08-15 01:10:23 | 37 | |
|
SARS-CoV-2 Spike-d18 Resource Report Resource Website |
RRID:Addgene_164583 | SARS-CoV-2 Spike | SARS-CoV-2 | Ampicillin | Codon-optimized SARS-CoV-2 Spike was cloned from SinoBiological plasmid VG40589-UT. An 18-amino acid truncation was introduced to improve expression. The plasmid can be used to generate Spike-pseudotyped lentiviral or VSV particles. | Backbone Marker:Vectorbuilder; Vector Backbone:pRP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Deleted amino acids 1256-1273 | 2026-08-15 01:09:22 | 0 | |
|
pSBbi-RP-CoV2/RBD-puro Resource Report Resource Website 1+ mentions |
RRID:Addgene_161793 | SARS-CoV-2 RBD | SARS-CoV-2 | Ampicillin | PMID:36619904 | The SARS-CoV-2 RBD insert was designed by Jorge L. Arias-Arias from Universidad de Costa Rica ([email protected]). This vector is suitable for transient transfection, but it was intended to be co-transfected with the transposase vector pCMV(CAT)T7-SB100 (Addgene Plasmid #34879) in order to generate stable mammalian cells for the production of SARS-CoV-2 RBD protein. This protein can be recovered from the cell culture medium by His-tag purification. The recombinant RBD is suitable for COVID-19 serology testing and monitoring of humoral responses in vaccinated population. | Backbone Marker:Eric Kowarz; Backbone Size:6625; Vector Backbone:pSBbi-RP (Addgene Plasmid #60513); Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin | 2026-08-15 01:08:57 | 2 | |
|
pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF6 Resource Report Resource Website |
RRID:Addgene_162817 | Ub-(N-TAG)CoV2_ORF6 | SARS-CoV-2 | Ampicillin | PMID:33175524 | Protein sequence: (TAG)FHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID - UniProtKB - P0DTC6 (NS6_SARS2) | Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | CoV2_ORF6(Met1,Amber) | 2026-08-15 01:09:05 | 0 |
|
pAS1_4x7SKPylT_EF1_Ub-*CoV2_9b Resource Report Resource Website |
RRID:Addgene_162816 | Ub-(N-TAG)CoV2_9b | SARS-CoV-2 | Ampicillin | PMID:33175524 | Protein sequence: (TAG)DPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK - UniProtKB - P0DTD2 (ORF9B_SARS2) | Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | CoV2_9b(Met1,Amber) | 2026-08-15 01:09:05 | 0 |
|
pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF3b_alt Resource Report Resource Website |
RRID:Addgene_162821 | Ub-(N-TAG)CoV2_ORF3b_alt | SARS-CoV-2 | Ampicillin | PMID:33175524 | Alternative ORF3b as described in Hachim et. al., 2020, (doi:10.1038/s41590-020-0773-7) - Protein sequence: (TAG)AYCWRCTSCCFSERFQNHNPQKEMATSTLQGCSLCLQLAVVVCNSLLTPFARCCWP | Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | CoV2_ORF3b_alt(Met1,Amber) | 2026-08-15 01:09:05 | 0 |
|
pET28-6His-TEV-Nsp14 Resource Report Resource Website 1+ mentions |
RRID:Addgene_154954 | 6His-TEV-Nsp14 | SARS-CoV-2 | Kanamycin | Backbone Size:5233; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:07:56 | 1 | |||
|
pET28-Strep-TEV-Nsp14 Resource Report Resource Website |
RRID:Addgene_154955 | Strep-TEV-Nsp14 | SARS-CoV-2 | Kanamycin | Backbone Size:5233; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:07:56 | 0 | |||
|
pET28-Nsp14-TEV-6His Resource Report Resource Website |
RRID:Addgene_154952 | Nsp14-TEV-6His | SARS-CoV-2 | Kanamycin | Backbone Size:5233; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:07:56 | 0 | |||
|
pET28-Nsp14-TEV-Strep Resource Report Resource Website |
RRID:Addgene_154953 | Nsp14-TEV-Strep | SARS-CoV-2 | Kanamycin | Backbone Size:5233; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:07:56 | 0 | |||
|
pET22-6His-SUMO-Nsp10 Resource Report Resource Website |
RRID:Addgene_154960 | 6His-SUMO-Nsp10 | SARS-CoV-2 | Ampicillin | Backbone Size:5375; Vector Backbone:pET22; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:07:56 | 0 | |||
|
pSBL_DK198 Resource Report Resource Website |
RRID:Addgene_156425 | SARS-CoV-2 3a protein (aa 42-275) | SARS-CoV-2 | Gentamicin | PMID:32587976 | Truncation made by PCR. Please visit https://www.biorxiv.org/lookup/doi/10.1101/2020.06.17.156554 for bioRxiv preprint. | Backbone Marker:Geneva Biotech; Vector Backbone:Derived from pACEBAC1; Vector Types:Insect Expression; Bacterial Resistance:Gentamicin | aa 42-275 | 2026-08-15 01:08:04 | 0 |
|
pSBL_DK202 Resource Report Resource Website |
RRID:Addgene_156426 | SARS-CoV-2 3a protein (aa 42-275) | SARS-CoV-2 | Ampicillin | PMID:32587976 | Please visit https://www.biorxiv.org/lookup/doi/10.1101/2020.06.17.156554 for bioRxiv preprint. | Backbone Marker:Eric Gouaux Lab; Vector Backbone:Derived from pEG BacMam; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | aa 42-275 | 2026-08-15 01:08:05 | 0 |
|
pSBL_DK186 Resource Report Resource Website |
RRID:Addgene_156422 | SARS-CoV-2 3a protein | SARS-CoV-2 | Ampicillin | PMID:32587976 | Please visit https://www.biorxiv.org/lookup/doi/10.1101/2020.06.17.156554 for bioRxiv preprint. | Backbone Marker:Eric Gouaux Lab; Vector Backbone:Derived from pEG BacMam; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:08:04 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.