Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Oryza sativa
Genetic Insert: OsNRAT-uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117866 Copy
Species: Zea mays
Genetic Insert: ZmNRAT-upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MEQAGDETPGEIGREAARREAALRSGGGDAGERVDKAVVDGGEDERFRVQRKWRRFLAHVGPGALVAIGFLDPSNLETDMQAGADFKYQLLWVILVGMVFALLIQTLAANLGVKTGKHLAELCREEYPRSVNICLWIIAEMAVISDDIPEVLGTAFAFNILLGIPLWAGVVLTVLSTLLLLGVQRFGARKLEFVVAAFMFAMAACFFGELSYLRPSAGEVVEGMFVPRLRGKGAAANAIALFGAIITPYNLFLHSALVLSRKTPRSVKSIRAACRYFLVECSLAFVVAFLINVAVVVVAGSICNAAGGNLSPADAAACGDLTLQSTPLLLRDVLGRSSSVVYAVALLASGQSTTISCTFAGQVIMQGFLDMRMKSWVRNLTTRAIAIAPSLVVSIVSGPSGAGKLIVFSSMVLSFELPFALIPLLKFCNSSNKVGPLKESIYTVVIAWALSFALIVVNTYFLVWTYVDWLVHSRLPKYATALLSVAVLALMAAYLAFVVYLAFRRDAVRTYVPVSERAEDGSGSQAVAAAASADDADMPAPFRKDLADASTE
Proper citation: RRID:Addgene_117865 Copy
Species: Arabidopsis thaliana
Genetic Insert: CBL5-uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117868 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT2 upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHDMPPPSPSSSSMSNHTTPHMMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIVIFLLAVIAEWLAHSPILRVSGSTNRAAGLAQTAVYTLKTGLSYLVMLAVMSFNAGVFIVAIAGYGVGFFLFGSTTFKKPSDDQKTAELLPPSSGCVCENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117901 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT2 uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHDMPPPSPSSSSMSNHTTPHMMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIVIFLLAVIAEWLAHSPILRVSGSTNRAAGLAQTAVYTLKTGLSYLVMLAVMSFNAGVFIVAIAGYGVGFFLFGSTTFKKPSDDQKTAELLPPSSGCVCENLYQSHHHHHH
Proper citation: RRID:Addgene_117900 Copy
Species: Oryza sativa
Genetic Insert: OsPQL upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MGIFSGAGAHRPSCPSAANCAKWAQTYLKYCLCSTRDGMALTLGLLSVISWGVAEVPQIITNYKHKSTEGLSLAFLMTWIVGDFFNLIGCFLEPETLPTQFYMALLYTITTVILTGQTVYYSHIYHRLKAKKARATSKPQRHQRADASLREKLLGPKVIGEIRNNSHLGATVPIPTSSPITVNTEIVRQRHGPSSLSEYYYTSARSLSSSPVPMSGTWSANYHQTNSPPEIDDQKESLVSEFSPAQYAASPLIKNSLSVVPWMSLLLGMSVLHFLVGTTHQEVPNGIVIPVGRRLLLLADDHADSSVSNGSGSGIGSFLGWAMAVIYMGGRLPQIWLNMKRGNAEGLNPLMFTFALVGNVTYVGSILVKSMDWSKLKPNLPWLVDAGGCVLLDTFIILQFLYFHYRKRHVPDEPDSADKVENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117895 Copy
Species: Oryza sativa
Genetic Insert: OsPQL uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MGIFSGAGAHRPSCPSAANCAKWAQTYLKYCLCSTRDGMALTLGLLSVISWGVAEVPQIITNYKHKSTEGLSLAFLMTWIVGDFFNLIGCFLEPETLPTQFYMALLYTITTVILTGQTVYYSHIYHRLKAKKARATSKPQRHQRADASLREKLLGPKVIGEIRNNSHLGATVPIPTSSPITVNTEIVRQRHGPSSLSEYYYTSARSLSSSPVPMSGTWSANYHQTNSPPEIDDQKESLVSEFSPAQYAASPLIKNSLSVVPWMSLLLGMSVLHFLVGTTHQEVPNGIVIPVGRRLLLLADDHADSSVSNGSGSGIGSFLGWAMAVIYMGGRLPQIWLNMKRGNAEGLNPLMFTFALVGNVTYVGSILVKSMDWSKLKPNLPWLVDAGGCVLLDTFIILQFLYFHYRKRHVPDEPDSADKVENLYQSHHHHHH
Proper citation: RRID:Addgene_117894 Copy
Species: Triticum aestivum
Genetic Insert: TaALMT1-uPIC 5'
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117890 Copy
Species: Triticum aestivum
Genetic Insert: TaALMT1-upGFP 3'
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117893 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT1 upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117899 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT1 uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSHHHHHH
Proper citation: RRID:Addgene_117898 Copy
Species: Oryza sativa
Genetic Insert: OsSLAC1
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MAAKPSSSSSSTGGHHTVDIRAAQAQPEDARQSAMSGPINIRGERRPPPMQRAFSRQVSLGSGVTVLGMDKVGKNGGRGQQRALPRSGKSLGVLNHTGALGQAAAGDGAARRGDFSMFRTKSTLSKQNSLLPSRIREPDLELPPHVEGPSVGRQGGEDPLNKSVPAGRYFAALRGPELDEVRDYEDILLPKDEVWPFLLRFPVGCFGVCLGLGSQAILWGALAASPAMRFLHVTPMINVALWLLALAVLVAVSVTYALKCVFYFEAIRREYFHPVRVNFFFAPSIAAMFLTIGLPRAVAPERLHPAVWCAFVAPLFGLELKIYGQWLSGGKRRLCKVANPSSHLSVVGNFVGAILAARVGWAEAGKFLWAIGVAHYIVVFVTLYQRLPTNEALPKELHPVYSMFIATPSAASLAWAAIYGSFDAVARTFFFMALFLYMSLVVRINFFRGFRFSIAWWSYTFPMTTASLATVKYAEAEPCFTSRALALSLSLMSTTMVSLLLVSTLLHAFVWRSLFPNDLAIAITKDRQNGAFKPHGKGRKAGKRVYDIKRWAKQAPLSLVSSITKSNSADKEEEEKTECGTENLYFQSGSHHHHHHHHHH
Proper citation: RRID:Addgene_117904 Copy
Species: Other
Genetic Insert: CAS9p-TagRFP
Vector Backbone Description: Vector Backbone:pDONR-221z; Vector Types:CRISPR; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:32601420
Proper citation: RRID:Addgene_118386 Copy
Species: Other
Genetic Insert: CAS9p
Vector Backbone Description: Vector Backbone:pDONR-221z; Vector Types:CRISPR; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:32601420
Proper citation: RRID:Addgene_118385 Copy
Species: Homo sapiens
Genetic Insert: p21
Vector Backbone Description: Backbone Marker:Invivogen; Vector Backbone:pCAG; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:23299246
Proper citation: RRID:Addgene_42623 Copy
Species: Homo sapiens
Genetic Insert: p21
Vector Backbone Description: Backbone Marker:Invivogen; Vector Backbone:pCAG; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:23299246
Proper citation: RRID:Addgene_40205 Copy
Vector Backbone Description: Backbone Marker:ExpreS2ion Biotechnologies; Backbone Size:2549; Vector Backbone:pExpreS2-1; Vector Types:Insect Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:35600892
Comments: This plasmid is designed for use with the ExpreS2 Platform from ExpreS2ion Biotechnologies. It is intended to be used with the ExpreS2ion cells and media which can be obtained directly from the ExpreS2ion website.
Proper citation: RRID:Addgene_175360 Copy
Vector Backbone Description: Backbone Marker:ExpreS2ion Biotechnologies; Backbone Size:3156; Vector Backbone:pExpreS2-1; Vector Types:Insect Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:35600892
Comments: This plasmid is designed for use with the ExpreS2 Platform from ExpreS2ion Biotechnologies. It is intended to be used with the ExpreS2ion cells and media which can be obtained directly from the ExpreS2ion website.
Proper citation: RRID:Addgene_175447 Copy
Vector Backbone Description: Backbone Marker:ExpreS2ion Biotechnologies; Backbone Size:2763; Vector Backbone:pExpreS2-1; Vector Types:Insect Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:35600892
Comments: This plasmid is designed for use with the ExpreS2 Platform from ExpreS2ion Biotechnologies. It is intended to be used with the ExpreS2ion cells and media which can be obtained directly from the ExpreS2ion website.
Proper citation: RRID:Addgene_175444 Copy
Vector Backbone Description: Backbone Marker:ExpreS2ion Biotechnologies; Backbone Size:3156; Vector Backbone:pExpreS2-1; Vector Types:Insect Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:35600892
Comments: This plasmid is designed for use with the ExpreS2 Platform from ExpreS2ion Biotechnologies. It is intended to be used with the ExpreS2ion cells and media which can be obtained directly from the ExpreS2ion website.
Proper citation: RRID:Addgene_175446 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.