Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
|||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
pLG-deltaA Resource Report Resource Website |
RRID:Addgene_33151 | RP51A-synthetic minimal intron | Saccharomyces cerevisiae | Ampicillin | PMID:2655924 | Original intron sequence: GTATGTTAATATGGTTAACGTCGACCGTGTTTTTGATATCTATACTAACAGGCCTTTTAATAG Modified intron sequence: GACCGTGTTTTTGATATCTATACTAACAGGCCTTTTAATAG | Vector Backbone:pLGSD5; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin | The RP51A sequence was modified by digestion with StyI and HincII, filled in and ligated to delete ~27bp including the 5' splice site | Addgene | 2026-10-31 02:08:59 | 0 |
|
pT7-L2-M3T3D Resource Report Resource Website 1+ mentions |
RRID:Addgene_33300 | L2 | Orthoreovirus T3D | Ampicillin | PMID:20042210 | Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Addgene | 2026-10-31 02:09:01 | 2 | ||
|
pT7-L1-M2T1L Resource Report Resource Website 1+ mentions |
RRID:Addgene_33303 | L1 | Orthoreovirus T1L | Ampicillin | PMID:20042210 | Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Addgene | 2026-10-31 02:09:01 | 2 | ||
|
pT7-L2-M3T1L Resource Report Resource Website 1+ mentions |
RRID:Addgene_33304 | L2 | Orthoreovirus T1L | Ampicillin | PMID:20042210 | Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Addgene | 2026-10-31 02:09:01 | 1 | ||
|
pT7-M2-S2-S3-S4T3D Resource Report Resource Website 1+ mentions |
RRID:Addgene_33302 | S2 | Orthoreovirus T3D | Ampicillin | PMID:20042210 | Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Addgene | 2026-10-31 02:09:01 | 2 | ||
|
pJMK001 Resource Report Resource Website 1+ mentions |
RRID:Addgene_33780 | Proteorhodopsin Optical Proton Sensor | uncultured proteobacterium EBAC31A08 | Ampicillin | PMID:21764748 | Backbone Marker:Invitrogen; Backbone Size:4127; Vector Backbone:pBAD TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | D97N | Addgene | 2026-10-31 02:09:01 | 3 | |
|
Ubc.Luc.IRES.Puro Resource Report Resource Website 1+ mentions |
RRID:Addgene_33307 | Firefly Luciferase | firefly | Ampicillin | PMID:21439256 | Backbone Marker:David Baltimore; Vector Backbone:cFUGW; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin | Addgene | 2026-10-31 02:09:01 | 5 | ||
|
cEF.tk-GFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_33308 | HSV-TK/GFP | Ampicillin | PMID:19114988 | Vector Backbone:cFUGW; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | Addgene | 2026-10-31 02:09:01 | 3 | |||
|
pcDNA3.1-mETV3 Resource Report Resource Website |
RRID:Addgene_33374 | Etv3 | Mus musculus | Ampicillin | PMID:18025162 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Addgene | 2026-10-31 02:09:01 | 0 | ||
|
pcDNA3.1-mETV3-HA Resource Report Resource Website |
RRID:Addgene_33375 | Etv3 | Mus musculus | Ampicillin | PMID:18025162 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Addgene | 2026-10-31 02:09:01 | 0 | ||
|
EcMBP165-cpGFP.PPYF.T203V.pRSET Resource Report Resource Website |
RRID:Addgene_33373 | Improved MBP based Maltose Biosensor | E. coli | Ampicillin | PMID:21989929 | The GFP-T203V mutation decreases the fluorescence emission of the apo state and increases that of the saturated state in GCaMP2. In the context of MBP165-cpGFP.PPYF, the T203V mutation decreases the fluorescence emission of the apo state by half, whereas saturated fluorescence and affinity are unchanged, increasing ΔF/F to 6.5. | Backbone Marker:Invitrogen; Backbone Size:2300; Vector Backbone:pRSET-A; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | cpGFP146 variant from GCaMP2 inserted between AA165-166 of MBP with T203V mutation in GFP. | Addgene | 2026-10-31 02:09:01 | 0 |
|
CMV500 A-CREB Resource Report Resource Website 1+ mentions |
RRID:Addgene_33371 | CREB | Mus musculus | Ampicillin | PMID:9447994 | A-CREB aa sequence: DYKDDDDK-MASMTGGQQMGRDPDLEQRAEELARENEELEKEAEELEQELAELENRVAVLENQNKTLIEELKALKDLYCHKSD. The first 8 aa encode for the FLAG tag, the next 13 aa area a φ10 protein sequence, the next 31 aa are the amphipathic acidic extension, and the final group of aa are the mouse CREB leucine zipper, which continues to the natural C terminus of the protein. | Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Dominant Negative (see notes) | Addgene | 2026-10-31 02:09:01 | 5 |
|
pBG100-TCPTP Resource Report Resource Website 1+ mentions |
RRID:Addgene_33365 | TCPTP-45 | Homo sapiens | Kanamycin | PMID:20940300 | Backbone Marker:Vanberbilt structural biology core plasmid; Vector Backbone:pBG100; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Addgene | 2026-10-31 02:09:01 | 2 | ||
|
pIRES-Puro-TCPTP Resource Report Resource Website 1+ mentions |
RRID:Addgene_33366 | TCPTP-45 | Homo sapiens | Ampicillin | PMID:20940300 | Backbone Marker:Clontech; Vector Backbone:pIRESpuro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Addgene | 2026-10-31 02:09:01 | 1 | ||
|
CMV500 A-C/EBPβ Resource Report Resource Website 1+ mentions |
RRID:Addgene_33363 | Cebpb | Mus musculus | Ampicillin | This is the dominant negative Cebpb- which contains an N-terminal acidic extension (LEQRAEELARENEELEKEAEELEQENAE) fused to the HLH-ZIP region of Cebpb. | Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Dominant Negative (see comments) | Addgene | 2026-10-31 02:09:01 | 3 | |
|
pGex-Cav1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_33364 | Cav1 | Homo sapiens | Ampicillin | PMID:20940300 | Backbone Marker:GE Healthcare; Vector Backbone:pGEX-6p; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Addgene | 2026-10-31 02:09:01 | 2 | ||
|
CMV500 A-ATF2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_33362 | ATF | Mus musculus | Ampicillin | This is the dominant negative ATF- which contains an N-terminal acidic extension fused to the HLH-ZIP region of ATF. | Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Dominant Negative (see comments) | Addgene | 2026-10-31 02:09:01 | 4 | |
|
pIRESNEO-Scambio-HA Resource Report Resource Website 1+ mentions |
RRID:Addgene_33354 | Scambio | Homo sapiens | Ampicillin | PMID:15107133 | Backbone Marker:Clontech; Backbone Size:5300; Vector Backbone:pIRESNEO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Addgene | 2026-10-31 02:09:01 | 2 | ||
|
CMV500 A-FOS Resource Report Resource Website 10+ mentions |
RRID:Addgene_33353 | FOS | Mus musculus | Ampicillin | PMID:9447994 | Acidic amphipathic extension added to the Fos leucine zipper: LEQRAEELARENEELEKEAEELEQELAE Although the acidic extension is to the c-Fos leucine zipper, A-Fos heterodimerizes and inhibits c-Jun. | Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Dominant Negative of c-Jun; heterodimerizes and inhibits c-Jun | Addgene | 2026-10-31 02:09:01 | 10 |
|
CMV500 A-SREBP2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_33358 | SREBP2 | Cricetulus griseus (hamster) | Ampicillin | PMID:14702347 | This is the dominant negative SREBP2- which contains an N-terminal acidic extension fused to the HLH-ZIP region of SREBP2. | Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Dominant Negative (see notes) | Addgene | 2026-10-31 02:09:01 | 2 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
