Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Aequorea victoria
Genetic Insert: EYFP
Vector Backbone Description: Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553
Proper citation: RRID:Addgene_104111 Copy
Species: Homo sapiens
Genetic Insert: human androgen receptor aa 4-52
Vector Backbone Description: Backbone Marker:Pharmacia; Vector Backbone:pGEX-4T-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15684378
Proper citation: RRID:Addgene_104199 Copy
Species: Synthetic
Genetic Insert: CheRiff-CFP
Vector Backbone Description: Backbone Size:9000; Vector Backbone:fCAG-FLEX; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30275587
Proper citation: RRID:Addgene_104114 Copy
Species: Homo sapiens
Genetic Insert: human androgen receptor aa 1-566
Vector Backbone Description: Backbone Marker:Pharmacia; Backbone Size:4900; Vector Backbone:pGEX-5x-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:10816582
Comments: The GST-AR insert has an insertion of 3 glutamine residues at amino acid 74 and a deletion of six amino acids (GGGGGE) after amino acid 466 compared to the listed reference sequence. The depositor has confirmed that this should not affect plasmid function.
Proper citation: RRID:Addgene_104195 Copy
Species: Aequorea victoria
Genetic Insert: mTurquoise2
Vector Backbone Description: Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553
Proper citation: RRID:Addgene_104110 Copy
Species: Rattus norvegicus
Genetic Insert: KCC2 (b isoform)
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4807; Vector Backbone:EGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28785725
Comments: In order to directly visualize the insertion of KCC2 IGE variants into the
membranes of single neurons, we created a novel construct encoding KCC2 with a pHluorine tag introduced into the second extracellular loop of the transporter , KCC2-pHex. See attached Scheme of KCC2-ext.pdf
Proper citation: RRID:Addgene_104076 Copy
Species: Synthetic
Genetic Insert: CheRiff-CFP
Vector Backbone Description: Backbone Size:4000; Vector Backbone:pAAV-hsyn-cre-off; Vector Types:Mammalian Expression, Adenoviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30275587
Proper citation: RRID:Addgene_104119 Copy
Species: Synthetic
Genetic Insert: somCheRiff-CFP
Vector Backbone Description: Backbone Size:9982; Vector Backbone:fCAG cre-on; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30275587
Proper citation: RRID:Addgene_104115 Copy
Species: Homo sapiens
Genetic Insert: ARHGAP12 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - TSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELPKYNAS
Proper citation: RRID:Addgene_104293 Copy
Species: Homo sapiens
Genetic Insert: KIAA0082 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - IVRTVNEPWTMGFSKSFKKKFFYNKKTKDSTFDLPADSI
Proper citation: RRID:Addgene_104288 Copy
Species: Homo sapiens
Genetic Insert: PQBP1 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - RLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPN
Proper citation: RRID:Addgene_104287 Copy
Species: Homo sapiens
Genetic Insert: NEDD4 WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - EPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDN
Proper citation: RRID:Addgene_104208 Copy
Species: Homo sapiens
Genetic Insert: NEDD4L WW domain #4
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - DLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNP
Proper citation: RRID:Addgene_104207 Copy
Species: Homo sapiens
Genetic Insert: NEDD4L WW domain #3
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - TQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFP
Proper citation: RRID:Addgene_104206 Copy
Species: Synthetic
Genetic Insert: Taz
Vector Backbone Description: Vector Backbone:p15a; Vector Types:Bacterial Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:29650958
Proper citation: RRID:Addgene_104333 Copy
Species: Homo sapiens
Genetic Insert: HLA-DQA2 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - QSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFI
Proper citation: RRID:Addgene_104297 Copy
Genetic Insert: TVA-mCherry fusion protein
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:AAV, Adeno Associated Viral Vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28689641
Proper citation: RRID:Addgene_104330 Copy
Species: Homo sapiens
Genetic Insert: ITCH WW domain #4
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - NEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKS
Proper citation: RRID:Addgene_104219 Copy
Species: Homo sapiens
Genetic Insert: WWP2 WW domain #4
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - QEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE
Proper citation: RRID:Addgene_104215 Copy
Species: Homo sapiens
Genetic Insert: WWP2 WW domain #3
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMI
Proper citation: RRID:Addgene_104214 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.