Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 249 showing 4961 ~ 4980 out of 740,584 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_48552

http://www.addgene.org/48552

Species: Synthetic
Genetic Insert: RVD sequence: NN NG NN NI
Vector Backbone Description: Vector Backbone:pFUS_B4; Vector Types:Mammalian Expression, TALEN; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:23734242
Comments: Plasmid was created using Golden Gate cloning.

Proper citation: RRID:Addgene_48552 Copy   


  • RRID:Addgene_48655

http://www.addgene.org/48655

Species: Synthetic
Genetic Insert: Bacterial TD crRNA to prototspacer A
Vector Backbone Description: Vector Backbone:p15A-cat; Vector Types:CRISPR; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48655 Copy   


  • RRID:Addgene_48654

http://www.addgene.org/48654

Species: Synthetic
Genetic Insert: Bacterial ST1 crRNA to prototspacer B
Vector Backbone Description: Vector Backbone:p15A-cat; Vector Types:CRISPR; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48654 Copy   


  • RRID:Addgene_48659

    This resource has 1+ mentions.

http://www.addgene.org/48659

Species: S. thermophilus #1
Genetic Insert: Cas9, nuclease-null
Vector Backbone Description: Vector Backbone:cloDF13-aadA; Vector Types:CRISPR; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48659 Copy   


  • RRID:Addgene_48649

http://www.addgene.org/48649

Species: Synthetic
Genetic Insert: Bacterial SP crRNA to prototspacer A
Vector Backbone Description: Vector Backbone:p15A-cat; Vector Types:CRISPR; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48649 Copy   


  • RRID:Addgene_48754

    This resource has 1+ mentions.

http://www.addgene.org/48754

Vector Backbone Description: Vector Backbone:Bluescript; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23582324
Comments: Plasmid map is theoretical and may not represent actual sequence. The presence of important plasmid features have been verified by sequencing.

Proper citation: RRID:Addgene_48754 Copy   


  • RRID:Addgene_48753

    This resource has 1+ mentions.

http://www.addgene.org/48753

Vector Backbone Description: Vector Backbone:Bluescript; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23582324
Comments: Plasmid map is theoretical and may not represent actual sequence. The presence of important plasmid features have been verified by sequencing.

Proper citation: RRID:Addgene_48753 Copy   


http://www.addgene.org/48756

Species: Mus musculus
Genetic Insert: Tfe3::ERT2
Vector Backbone Description: Vector Backbone:Bluescript; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23582324

Proper citation: RRID:Addgene_48756 Copy   


  • RRID:Addgene_48751

http://www.addgene.org/48751

Species: Mus musculus
Genetic Insert: Fbxl3
Vector Backbone Description: Backbone Marker:Sigma; Backbone Size:6299; Vector Backbone:p3xFLAG-CMV-10; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17462724

Proper citation: RRID:Addgene_48751 Copy   


  • RRID:Addgene_48745

http://www.addgene.org/48745

Species: Mus musculus
Genetic Insert: truncated mPer2 promoter/enhancer region (-1128 to +2064)
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-Basic; Vector Types:Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15699353
Comments: Minor sequencing discrepancies may exist between the mPer2 promoter reference sequence and Addgene's sequencing results, but do not affect the function of the plasmid.

Proper citation: RRID:Addgene_48745 Copy   


  • RRID:Addgene_48740

http://www.addgene.org/48740

Species: Caenorhabditis elegans
Genetic Insert: C. elegans UNC-60B cDNA
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:459; Vector Backbone:pET-3d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9452511
Comments: Please see the insert sequence provided by the depositing laboratory and Figure 1 from the associated publication (Ono S and Benian GM, JBC 1998) listed below for information on the UNC-60 isoform in this plasmid. This plasmid encodes the UNC-60B isoform as described in the publication and now referred to as UNC-60C by NCBI and Wormbase (GenBank reference sequence NP_503427.2). The original nomenclature of UNC-60A and UNC-60B was defined in the publication "Genetic organization of the unc-60 region in Caenorhabditis elegans." McKim KS, Heschl MF, Rosenbluth RE, Baillie DL. Genetics. 1988 Jan;118(1):49-59. https://www.ncbi.nlm.nih.gov/pubmed/8608931

Proper citation: RRID:Addgene_48740 Copy   


  • RRID:Addgene_48699

http://www.addgene.org/48699

Vector Backbone Description: Backbone Size:5775; Vector Backbone:pXOON; Vector Types:Mammalian Expression, Xenopus Oocyte Expression; Bacterial Resistance:Kanamycin

Proper citation: RRID:Addgene_48699 Copy   


http://www.addgene.org/48730

Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.

Proper citation: RRID:Addgene_48730 Copy   


http://www.addgene.org/48692

Species: Homo sapiens
Genetic Insert: FlagHA FMR1 Iso 1 I304N
Vector Backbone Description: Backbone Marker:Life Technologies, Modified by Tuschl Lab; Backbone Size:5322; Vector Backbone:pcDNA5/FRT/TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23235829

Proper citation: RRID:Addgene_48692 Copy   


  • RRID:Addgene_48728

http://www.addgene.org/48728

Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.

Proper citation: RRID:Addgene_48728 Copy   


  • RRID:Addgene_48722

http://www.addgene.org/48722

Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.

Proper citation: RRID:Addgene_48722 Copy   


  • RRID:Addgene_48688

    This resource has 10+ mentions.

http://www.addgene.org/48688

Vector Backbone Description: Backbone Marker:Malcolm Moore lab; Vector Backbone:pUltra-Chili; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34088832
Comments: See Addgene plasmid #24129 for cloning details.

Proper citation: RRID:Addgene_48688 Copy   


  • RRID:Addgene_48721

http://www.addgene.org/48721

Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.

Proper citation: RRID:Addgene_48721 Copy   


  • RRID:Addgene_48687

    This resource has 10+ mentions.

http://www.addgene.org/48687

Vector Backbone Description: Backbone Marker:Malcolm Moore lab; Backbone Size:8300; Vector Backbone:pUltra; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Comments: See Addgene plasmid #24129 for cloning details.

Proper citation: RRID:Addgene_48687 Copy   


  • RRID:Addgene_48720

http://www.addgene.org/48720

Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. Lacritin protein sequence in this plasmid is: SILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA

Proper citation: RRID:Addgene_48720 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X