Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Synthetic
Genetic Insert: RVD sequence: NN NG NN NI
Vector Backbone Description: Vector Backbone:pFUS_B4; Vector Types:Mammalian Expression, TALEN; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:23734242
Comments: Plasmid was created using Golden Gate cloning.
Proper citation: RRID:Addgene_48552 Copy
Species: Synthetic
Genetic Insert: Bacterial TD crRNA to prototspacer A
Vector Backbone Description: Vector Backbone:p15A-cat; Vector Types:CRISPR; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:24076762
Proper citation: RRID:Addgene_48655 Copy
Species: Synthetic
Genetic Insert: Bacterial ST1 crRNA to prototspacer B
Vector Backbone Description: Vector Backbone:p15A-cat; Vector Types:CRISPR; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:24076762
Proper citation: RRID:Addgene_48654 Copy
Species: S. thermophilus #1
Genetic Insert: Cas9, nuclease-null
Vector Backbone Description: Vector Backbone:cloDF13-aadA; Vector Types:CRISPR; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24076762
Proper citation: RRID:Addgene_48659 Copy
Species: Synthetic
Genetic Insert: Bacterial SP crRNA to prototspacer A
Vector Backbone Description: Vector Backbone:p15A-cat; Vector Types:CRISPR; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:24076762
Proper citation: RRID:Addgene_48649 Copy
Vector Backbone Description: Vector Backbone:Bluescript; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23582324
Comments: Plasmid map is theoretical and may not represent actual sequence. The presence of important plasmid features have been verified by sequencing.
Proper citation: RRID:Addgene_48754 Copy
Vector Backbone Description: Vector Backbone:Bluescript; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23582324
Comments: Plasmid map is theoretical and may not represent actual sequence. The presence of important plasmid features have been verified by sequencing.
Proper citation: RRID:Addgene_48753 Copy
Species: Mus musculus
Genetic Insert: Tfe3::ERT2
Vector Backbone Description: Vector Backbone:Bluescript; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23582324
Proper citation: RRID:Addgene_48756 Copy
Species: Mus musculus
Genetic Insert: Fbxl3
Vector Backbone Description: Backbone Marker:Sigma; Backbone Size:6299; Vector Backbone:p3xFLAG-CMV-10; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17462724
Proper citation: RRID:Addgene_48751 Copy
Species: Mus musculus
Genetic Insert: truncated mPer2 promoter/enhancer region (-1128 to +2064)
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-Basic; Vector Types:Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15699353
Comments: Minor sequencing discrepancies may exist between the mPer2 promoter reference sequence and Addgene's sequencing results, but do not affect the function of the plasmid.
Proper citation: RRID:Addgene_48745 Copy
Species: Caenorhabditis elegans
Genetic Insert: C. elegans UNC-60B cDNA
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:459; Vector Backbone:pET-3d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9452511
Comments: Please see the insert sequence provided by the depositing laboratory and Figure 1 from the associated publication (Ono S and Benian GM, JBC 1998) listed below for information on the UNC-60 isoform in this plasmid. This plasmid encodes the UNC-60B isoform as described in the publication and now referred to as UNC-60C by NCBI and Wormbase (GenBank reference sequence NP_503427.2).
The original nomenclature of UNC-60A and UNC-60B was defined in the publication "Genetic organization of the unc-60 region in Caenorhabditis elegans." McKim KS, Heschl MF, Rosenbluth RE, Baillie DL. Genetics. 1988 Jan;118(1):49-59. https://www.ncbi.nlm.nih.gov/pubmed/8608931
Proper citation: RRID:Addgene_48740 Copy
Vector Backbone Description: Backbone Size:5775; Vector Backbone:pXOON; Vector Types:Mammalian Expression, Xenopus Oocyte Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_48699 Copy
Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.
Proper citation: RRID:Addgene_48730 Copy
Species: Homo sapiens
Genetic Insert: FlagHA FMR1 Iso 1 I304N
Vector Backbone Description: Backbone Marker:Life Technologies, Modified by Tuschl Lab; Backbone Size:5322; Vector Backbone:pcDNA5/FRT/TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23235829
Proper citation: RRID:Addgene_48692 Copy
Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.
Proper citation: RRID:Addgene_48728 Copy
Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.
Proper citation: RRID:Addgene_48722 Copy
Vector Backbone Description: Backbone Marker:Malcolm Moore lab; Vector Backbone:pUltra-Chili; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34088832
Comments: See Addgene plasmid #24129 for cloning details.
Proper citation: RRID:Addgene_48688 Copy
Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.
Proper citation: RRID:Addgene_48721 Copy
Vector Backbone Description: Backbone Marker:Malcolm Moore lab; Backbone Size:8300; Vector Backbone:pUltra; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Comments: See Addgene plasmid #24129 for cloning details.
Proper citation: RRID:Addgene_48687 Copy
Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.
Lacritin protein sequence in this plasmid is: SILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA
Proper citation: RRID:Addgene_48720 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.