Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
|||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
pMaCTag-09 Resource Report Resource Website |
RRID:Addgene_119988 | mVenus | Homo sapiens | Ampicillin | PMID:32406907 | Template plasmid for C-terminal PCR tagging of mammalian genes. For M1 and M2 tagging oligo design please visit www.pcr-tagging.com Please visit https://www.biorxiv.org/content/early/2018/11/20/473876 for BioRxiv preprint | Backbone Size:2412; Vector Backbone:pFA6a; Vector Types:PCR Template; Bacterial Resistance:Ampicillin | Addgene | 2026-10-24 02:04:15 | 0 | |
|
pMaCTag-10 Resource Report Resource Website |
RRID:Addgene_119989 | mKOk | Homo sapiens | Ampicillin | PMID:32406907 | Template plasmid for C-terminal PCR tagging of mammalian genes. For M1 and M2 tagging oligo design please visit www.pcr-tagging.com Please visit https://www.biorxiv.org/content/early/2018/11/20/473876 for BioRxiv preprint | Backbone Size:2412; Vector Backbone:pFA6a; Vector Types:PCR Template; Bacterial Resistance:Ampicillin | Addgene | 2026-10-24 02:04:15 | 0 | |
|
LentiV_Neo_Sik3_T142Q Resource Report Resource Website |
RRID:Addgene_119973 | Sik3 | Mus musculus | Ampicillin | PMID:31697837 | Please visit https://www.biorxiv.org/content/10.1101/636969v1 for BioRxiv preprint | Backbone Size:7210; Vector Backbone:LentiV_Neo; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | change Threonine 142 to Glutamine | Addgene | 2026-10-24 02:04:15 | 0 |
|
GAG-CRErec Resource Report Resource Website 1+ mentions |
RRID:Addgene_119971 | GAG-nlsCRErec | Homo sapiens | Ampicillin | PMID:30604748 | Please visit https://www.biorxiv.org/content/early/2017/10/12/202010 for BioRxiv preprint. | Vector Backbone:pcDNA3-like; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Addgene | 2026-10-24 02:04:15 | 2 | |
|
LentiV_Neo_Sik3 Resource Report Resource Website |
RRID:Addgene_119972 | Sik3 | Mus musculus | Ampicillin | PMID:31697837 | Please visit https://www.biorxiv.org/content/10.1101/636969v1 for BioRxiv preprint | Backbone Size:7210; Vector Backbone:LentiV_Neo; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | Addgene | 2026-10-24 02:04:15 | 0 | |
|
pCAGGS-FuG-E (P440E) Resource Report Resource Website 1+ mentions |
RRID:Addgene_119978 | Fusion Glycoprotein type E (P440E) | Gallus gallus | Ampicillin | PMID:30347222 | Addgene NGS was unable to fully resolve the sequence of the CAGGS promoter. Please refer to the depositor's sequence for this section of the plasmid. | Backbone Size:4900; Vector Backbone:pCAGGS vector; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | Addgene | 2026-10-24 02:04:15 | 1 | |
|
6CVZ (RFWD3) Resource Report Resource Website |
RRID:Addgene_119964 | RFWD3 | Homo sapiens | Ampicillin | N-Tag: MHHHHHHSSGRENLYFQG. RFWD3:YTC049-E07:C240603. SGC link: http://www.thesgc.org/structures/6CVZ/ | Backbone Marker:SGC (Addgene Plasmid #62304); Vector Backbone:pFBOH-MHL; Vector Types:Baculovirus Expression; Bacterial Resistance:Ampicillin | Addgene | 2026-10-24 02:04:15 | 0 | ||
|
6CW0 (cgd2_2690) Resource Report Resource Website |
RRID:Addgene_119965 | cgd2_2690 | Cryptosporidium parvum | Ampicillin | N-Tag: MHHHHHHSSGRENLYFQG. cgd2_2690:MAC04R-G03:C231067. SGC link: http://www.thesgc.org/structures/6CW0/ | Backbone Marker:SGC (Addgene Plasmid #26092); Vector Backbone:pET15-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | contains amino acids 1-105 | Addgene | 2026-10-24 02:04:15 | 0 | |
|
6CKO (DOT1L) Resource Report Resource Website |
RRID:Addgene_119962 | DOT1L | Homo sapiens | Kanamycin | N-Tag: MKKHHHHHHHHSSGLVPRGSMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGTENLYFQG. DOT1L:JMC107-B04:C239899. SGC link: http://www.thesgc.org/structures/6CKO/ | Backbone Marker:SGC (Addgene Plasmid #79526); Vector Backbone:pET28-MKH8SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Addgene | 2026-10-24 02:04:15 | 0 | ||
|
6CCR (GID4) Resource Report Resource Website |
RRID:Addgene_119960 | GID4 | Homo sapiens | Kanamycin | N-Tag:MKKHHHHHHHHSSGLVPRGSMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGTENLYFQG. GID4:JMC130-A03:C240642. SGC link: http://www.thesgc.org/structures/6CCR/ | Backbone Marker:SGC (Addgene Plasmid #79526); Vector Backbone:pET28-MKH8SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | contains amino acids 116-300 | Addgene | 2026-10-24 02:04:15 | 0 | |
|
6CDG (GID4) Resource Report Resource Website |
RRID:Addgene_119961 | GID4 | Homo sapiens | Kanamycin | N-Tag:MHHHHHHSSGRENLYFQG. GID4:JMC130-A04:C240838. SGC links: https://www.thesgc.org/structures/6CDG/ https://www.thesgc.org/structures/6WZZ/ https://www.thesgc.org/structures/7S12/ https://www.thesgc.org/structures/7SLZ/ | Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | contains amino acids 124-289 | Addgene | 2026-10-24 02:04:15 | 0 | |
|
6DUB (LOC149281) Resource Report Resource Website |
RRID:Addgene_119967 | LOC149281 | Homo sapiens | Kanamycin | N-Tag: MKKHHHHHHHHSSGLVPRGSMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGTENLYFQG. LOC149281:JMC119-E02:C237152. SGC link: http://www.thesgc.org/structures/6DUB/ | Backbone Marker:SGC (Addgene Plasmid #79526); Vector Backbone:pET28-MKH8SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | contains amino acids 58-278 | Addgene | 2026-10-24 02:04:15 | 0 | |
|
6ASB (FBXL19) Resource Report Resource Website |
RRID:Addgene_119954 | FBXL19 | Homo sapiens | Kanamycin | N-Tag:MHHHHHHSSGRENLYFQG. FBXL19:JMC067-G03:C226959. SGC link: http://www.thesgc.org/structures/6ASB/ | Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | contains amino acids 31-153 | Addgene | 2026-10-24 02:04:15 | 0 | |
|
pGL Resource Report Resource Website |
RRID:Addgene_119952 | gpps | Abies grandis | Ampicillin | PMID:30563328 | Backbone Marker:Lee, Taek Soon, et al. "BglBrick vectors and datasheets: a synthetic biology platform for gene expression." Journal of biologica; Vector Backbone:pBbB2a-GFP; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | N-terminal truncation of 85 amino acid residues (signal sequence) | Addgene | 2026-10-24 02:04:15 | 0 | |
|
6CC8 (MBD3) Resource Report Resource Website |
RRID:Addgene_119959 | MBD3 | Homo sapiens | Kanamycin | N-Tag: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPRGS. MBD3:JMC065-E03:C226116. SGC link: http://www.thesgc.org/structures/6CC8/ https://www.thesgc.org/structures/6CCG/ | Backbone Marker:SGC (Addgene Plasmid #26101); Vector Backbone:pET28GST-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | MBD domain (contains residues 1-71) | Addgene | 2026-10-24 02:04:15 | 0 | |
|
6BYB (L3MBTL1) Resource Report Resource Website |
RRID:Addgene_119957 | L3MBTL1 | Homo sapiens | Kanamycin | N-Tag:MHHHHHHSSGRENLYFQG. L3MBTL1:APC053-A03:C30586. SGC link: http://www.thesgc.org/structures/6BYB/ | Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Addgene | 2026-10-24 02:04:15 | 0 | ||
|
6C1A (MBD2) Resource Report Resource Website |
RRID:Addgene_119958 | MBD2 | Homo sapiens | Kanamycin | N-Tag:MHHHHHHSSGRENLYFQG. MBD2:JMC01O-G01:C207125. SGC links: http://www.thesgc.org/structures/6C1A/ http://www.thesgc.org/structures/6C1T/ http://www.thesgc.org/structures/6C1V/ http://www.thesgc.org/structures/6CNP/ | Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Addgene | 2026-10-24 02:04:15 | 0 | ||
|
pMaCTag-P33 Resource Report Resource Website |
RRID:Addgene_120018 | FLAG | Homo sapiens | Ampicillin | PMID:32406907 | Template plasmid for C-terminal PCR tagging of mammalian genes. For M1 and M2 tagging oligo design please visit www.pcr-tagging.com Please visit https://www.biorxiv.org/content/early/2018/11/20/473876 for BioRxiv preprint | Backbone Size:2412; Vector Backbone:pFA6a; Vector Types:PCR Template; Bacterial Resistance:Ampicillin | Addgene | 2026-10-24 02:04:16 | 0 | |
|
pMaCTag-P06 Resource Report Resource Website |
RRID:Addgene_120017 | sfGFP | Homo sapiens | Ampicillin | PMID:32406907 | Template plasmid for C-terminal PCR tagging of mammalian genes. For M1 and M2 tagging oligo design please visit www.pcr-tagging.com Please visit https://www.biorxiv.org/content/early/2018/11/20/473876 for BioRxiv preprint | Backbone Size:2412; Vector Backbone:pFA6a; Vector Types:PCR Template; Bacterial Resistance:Ampicillin | Addgene | 2026-10-24 02:04:16 | 0 | |
|
pAM4891 (pCV0003) Resource Report Resource Website 1+ mentions |
RRID:Addgene_120080 | Plasmid assembled from 3 CYANO-VECTOR modular devices: CV-RSF1010Y25F, CV-aph1, CV-PconII-LTRBS-GFPmut2 | Broad range of bacteria | Kanamycin | PMID:25074377 | Backbone Size:7846; Vector Backbone:RSF1010Y25F_aph1_PconII-GFPmut2; Vector Types:Other; Bacterial Resistance:Kanamycin | mobA Y25F | Addgene | 2026-10-24 02:04:16 | 2 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
