Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: GAG-nlsCRErec
Vector Backbone Description: Vector Backbone:pcDNA3-like; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30604748
Comments: Please visit https://www.biorxiv.org/content/early/2017/10/12/202010 for BioRxiv preprint.
Proper citation: RRID:Addgene_119971 Copy
Species: Mus musculus
Genetic Insert: Sik3
Vector Backbone Description: Backbone Size:7210; Vector Backbone:LentiV_Neo; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31697837
Comments: Please visit https://www.biorxiv.org/content/10.1101/636969v1 for BioRxiv preprint
Proper citation: RRID:Addgene_119972 Copy
Species: Gallus gallus
Genetic Insert: Fusion Glycoprotein type E (P440E)
Vector Backbone Description: Backbone Size:4900; Vector Backbone:pCAGGS vector; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30347222
Comments: Addgene NGS was unable to fully resolve the sequence of the CAGGS promoter. Please refer to the depositor's sequence for this section of the plasmid.
Proper citation: RRID:Addgene_119978 Copy
Species: Homo sapiens
Genetic Insert: RFWD3
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #62304); Vector Backbone:pFBOH-MHL; Vector Types:Baculovirus Expression; Bacterial Resistance:Ampicillin
Comments: N-Tag: MHHHHHHSSGRENLYFQG. RFWD3:YTC049-E07:C240603. SGC link: http://www.thesgc.org/structures/6CVZ/
Proper citation: RRID:Addgene_119964 Copy
Species: Cryptosporidium parvum
Genetic Insert: cgd2_2690
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26092); Vector Backbone:pET15-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: N-Tag: MHHHHHHSSGRENLYFQG. cgd2_2690:MAC04R-G03:C231067. SGC link: http://www.thesgc.org/structures/6CW0/
Proper citation: RRID:Addgene_119965 Copy
Species: Homo sapiens
Genetic Insert: DOT1L
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #79526); Vector Backbone:pET28-MKH8SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag: MKKHHHHHHHHSSGLVPRGSMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGTENLYFQG. DOT1L:JMC107-B04:C239899. SGC link: http://www.thesgc.org/structures/6CKO/
Proper citation: RRID:Addgene_119962 Copy
Species: Homo sapiens
Genetic Insert: GID4
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #79526); Vector Backbone:pET28-MKH8SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MKKHHHHHHHHSSGLVPRGSMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGTENLYFQG. GID4:JMC130-A03:C240642. SGC link: http://www.thesgc.org/structures/6CCR/
Proper citation: RRID:Addgene_119960 Copy
Species: Homo sapiens
Genetic Insert: GID4
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MHHHHHHSSGRENLYFQG. GID4:JMC130-A04:C240838.
SGC links:
https://www.thesgc.org/structures/6CDG/
https://www.thesgc.org/structures/6WZZ/
https://www.thesgc.org/structures/7S12/
https://www.thesgc.org/structures/7SLZ/
Proper citation: RRID:Addgene_119961 Copy
Species: Homo sapiens
Genetic Insert: LOC149281
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #79526); Vector Backbone:pET28-MKH8SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag: MKKHHHHHHHHSSGLVPRGSMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGTENLYFQG. LOC149281:JMC119-E02:C237152. SGC link: http://www.thesgc.org/structures/6DUB/
Proper citation: RRID:Addgene_119967 Copy
Species: Homo sapiens
Genetic Insert: FBXL19
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MHHHHHHSSGRENLYFQG. FBXL19:JMC067-G03:C226959. SGC link: http://www.thesgc.org/structures/6ASB/
Proper citation: RRID:Addgene_119954 Copy
Species: Abies grandis
Genetic Insert: gpps
Vector Backbone Description: Backbone Marker:Lee, Taek Soon, et al. "BglBrick vectors and datasheets: a synthetic biology platform for gene expression." Journal of biologica; Vector Backbone:pBbB2a-GFP; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30563328
Proper citation: RRID:Addgene_119952 Copy
Species: Homo sapiens
Genetic Insert: MBD3
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26101); Vector Backbone:pET28GST-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPRGS. MBD3:JMC065-E03:C226116. SGC link: http://www.thesgc.org/structures/6CC8/
https://www.thesgc.org/structures/6CCG/
Proper citation: RRID:Addgene_119959 Copy
Species: Homo sapiens
Genetic Insert: L3MBTL1
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MHHHHHHSSGRENLYFQG. L3MBTL1:APC053-A03:C30586. SGC link: http://www.thesgc.org/structures/6BYB/
Proper citation: RRID:Addgene_119957 Copy
Species: Homo sapiens
Genetic Insert: MBD2
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MHHHHHHSSGRENLYFQG. MBD2:JMC01O-G01:C207125. SGC links: http://www.thesgc.org/structures/6C1A/
http://www.thesgc.org/structures/6C1T/
http://www.thesgc.org/structures/6C1V/
http://www.thesgc.org/structures/6CNP/
Proper citation: RRID:Addgene_119958 Copy
Species: Homo sapiens
Genetic Insert: EGFR
Vector Backbone Description: Vector Backbone:pHAGE; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29533785
Proper citation: RRID:Addgene_116278 Copy
Species: Homo sapiens
Genetic Insert: EGFR
Vector Backbone Description: Vector Backbone:pHAGE; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29533785
Proper citation: RRID:Addgene_116279 Copy
Species: Homo sapiens
Genetic Insert: EGFR
Vector Backbone Description: Vector Backbone:pHAGE; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29533785
Proper citation: RRID:Addgene_116273 Copy
Species: Homo sapiens
Genetic Insert: EGFR
Vector Backbone Description: Vector Backbone:pHAGE; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29533785
Proper citation: RRID:Addgene_116274 Copy
Species: Homo sapiens
Genetic Insert: EGFR
Vector Backbone Description: Vector Backbone:pHAGE; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29533785
Proper citation: RRID:Addgene_116276 Copy
Species: Homo sapiens
Genetic Insert: EGFR
Vector Backbone Description: Vector Backbone:pHAGE; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29533785
Proper citation: RRID:Addgene_116280 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
