Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Genetic Insert: sgRNA targeting position 9 in pColE1_70a_deGFP_KanR
Vector Backbone Description: Vector Backbone:YTK095; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32995532
Comments: Marshall et al. 2018 (PMID: 29304331)
Proper citation: RRID:Addgene_119152 Copy
Species: Aequorea victoria
Genetic Insert: pRSETA-PAGFP
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:2827; Vector Backbone:pRSETA; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12228718
Comments: The fluorescent protein encoding region contains one of the three substitutions (A206K) suggested by Dr. Roger Tsien. This mutation disrupts fluorescent protein dimerization even at high concentrations. The mutation does not seem to have much effect on the fluorescent properties of the CFP, GFP and YFP versions, so hopefully it will not affect PAGFP too much. The PAGFP A206K mutant does not display obvious fluorescent differences compared with the original, but please bear in mind that I haven't characterized it to the same extent.
The citation for the A206K mutation in fluorescent proteins is Science 2002 296:913.
Proper citation: RRID:Addgene_11911 Copy
Species: Aequorea victoria
Genetic Insert: PAGFP
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4731; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:12228718
Comments: The pPAGFP-C1 was not published. It was prepared by removing the PAGFP cDNA from pPAGFP-N1 with an AgeI/BsrGI restriction digest and subcloning it into a similarly digested pEYFP-C1 (Clontech). The pPAGFP-C1 was confirmed by sequencing. If you use this construct in future publications, use your best judgement for citation.
The fluorescent protein encoding region contains one of the three substitutions (A206K) suggested by Dr. Roger Tsien. This mutation disrupts fluorescent protein dimerization even at high concentrations. The mutation does not seem to have much effect on the fluorescent properties of the CFP, GFP and YFP versions, so hopefully it will not affect PAGFP too much. The PAGFP A206K mutant does not display obvious fluorescent differences compared with the original, but please bear in mind that I haven't characterized it to the same extent.
The citation for the A206K mutation in fluorescent proteins is Science 2002 296:913.
Proper citation: RRID:Addgene_11910 Copy
Species: Homo sapiens
Genetic Insert: APOBEC3G-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119139 Copy
Species: Homo sapiens
Genetic Insert: APOBEC3F-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119138 Copy
Species: Homo sapiens
Genetic Insert: APOBEC3B L1 intron-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119135 Copy
Species: Homo sapiens
Genetic Insert: APOBEC3C-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119136 Copy
Genetic Insert: eGFP L138 gRNA
Vector Backbone Description: Backbone Marker:Joung Lab; Backbone Size:2278; Vector Backbone:MLM3636; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119133 Copy
Species: Homo sapiens
Genetic Insert: APOBEC3H Haplotype II RR175/6EE-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119142 Copy
Species: Homo sapiens
Genetic Insert: APOBEC3H Haplotype II-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119141 Copy
Species: Mus musculus
Genetic Insert: mPLD2-PX (62-192)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Proper citation: RRID:Addgene_119128 Copy
Genetic Insert: mCherry and eGFP
Vector Backbone Description: Backbone Size:9990; Vector Backbone:plenti-CMV-mCherry-T2A-GFP; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119129 Copy
Species: Homo sapiens
Genetic Insert: RICS-PX (127-255)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: NVEFGSIQLSLSEEQNEVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLDKHLHLCIYDRRFSQLSELPRSDTLKDSPESVTQMLMAYLSRLSAIAGNKINCGPALTWMEIDNKGNHLLVHEESS
Proper citation: RRID:Addgene_119126 Copy
Species: Homo sapiens
Genetic Insert: p47phox-PX (1-122)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCGTLMSLPTKISRCPHLLDFFKVRP
Proper citation: RRID:Addgene_119124 Copy
Species: Homo sapiens
Genetic Insert: SNX8-PX (70-190)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: ELLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGADREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESA
Proper citation: RRID:Addgene_119089 Copy
Species: Homo sapiens
Genetic Insert: SNX17-PX (1-111)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFPPKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQ
Proper citation: RRID:Addgene_119098 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: N-terminus of Sup35
Vector Backbone Description: Backbone Marker:Thiele; Backbone Size:0; Vector Backbone:pCLUC; Vector Types:Yeast Expression, CUP1 promoter; Bacterial Resistance:Ampicillin
Defining Citation: PMID:8662547
Proper citation: RRID:Addgene_1191 Copy
Genetic Insert: eGFP L202 gRNA
Vector Backbone Description: Backbone Marker:Joung Lab; Backbone Size:2278; Vector Backbone:MLM3636; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119132 Copy
Species: Homo sapiens
Genetic Insert: SNX15-PX (1-127)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: MSRQAKDDFLRHYTVSDPRTHPKGYTEYKVTAQFISKKDPEDVKEVVVWKRYSDFRKLHGDLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLKEFFRGG
Proper citation: RRID:Addgene_119096 Copy
Genetic Insert: mCherry and eGFP
Vector Backbone Description: Backbone Size:9990; Vector Backbone:plenti-CMV-mCherry-T2A-GFP; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119130 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
