Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), with interdomain A (Phe 119 to His 162) substituted by a flexible 20aa linker
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPGGSGGSGGSGSGGSGGSGGSEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ
Proper citation: RRID:Addgene_111272 Copy
Species: Synthetic
Genetic Insert: ChETA-mRuby2
Vector Backbone Description: Backbone Size:4116; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29879392
Proper citation: RRID:Addgene_111389 Copy
Vector Backbone Description: Backbone Size:3154; Vector Backbone:pScaf; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30984875
Comments: Preprint available at https://www.biorxiv.org/content/early/2018/04/27/309682
Proper citation: RRID:Addgene_111401 Copy
Genetic Insert: pScaf-7560.1
Vector Backbone Description: Backbone Size:3154; Vector Backbone:pScaf; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30984875
Comments: Preprint available at https://www.biorxiv.org/content/early/2018/04/27/309682
Proper citation: RRID:Addgene_111406 Copy
Species: Homo sapiens
Genetic Insert: potassium voltage-gated channel subfamily KQT member 1 isoform 1 [Homo sapiens]
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29429937
Proper citation: RRID:Addgene_111452 Copy
Species: Synthetic
Genetic Insert: CaCas9/sgScADE2/stop-codon repair
Vector Backbone Description: Backbone Marker:RS Sikorski; Vector Backbone:pRS416; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29695624
Proper citation: RRID:Addgene_111444 Copy
Species: Mus musculus
Genetic Insert: mCAR
Vector Backbone Description: Backbone Size:4836; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29879392
Proper citation: RRID:Addgene_111393 Copy
Species: Homo sapiens
Genetic Insert: hCAR
Vector Backbone Description: Backbone Size:4117; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29879392
Proper citation: RRID:Addgene_111397 Copy
Species: Synthetic
Genetic Insert: CaCas9/sgRNA-BsmBI stuffer
Vector Backbone Description: Backbone Marker:RS Sikorski; Vector Backbone:pRS416; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29695624
Proper citation: RRID:Addgene_111436 Copy
Species: Synthetic
Genetic Insert: CaCas9/sgRNA-BsmBI stuffer
Vector Backbone Description: Backbone Marker:RS Sikorski; Vector Backbone:pRS416; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29695624
Proper citation: RRID:Addgene_111435 Copy
Species: Rattus norvegicus
Genetic Insert: PKC zeta
Vector Backbone Description: Backbone Size:4650; Vector Backbone:pCMV5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9768361
Proper citation: RRID:Addgene_10801 Copy
Species: Acidaminococcus sp. BV3L6
Genetic Insert: human codon optimized enAsCas12a-HF1 (E174R/N282A/S542R/K548R)
Vector Backbone Description: Backbone Marker:Connie Cepko lab (Addgene plasmid #11179); Vector Backbone:pCAG-CFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30742127
Proper citation: RRID:Addgene_107942 Copy
Species: Acidaminococcus sp. BV3L6
Genetic Insert: human codon optimized enAsCas12a (E174R/S542R/K548R)
Vector Backbone Description: Backbone Marker:Connie Cepko lab (Addgene plasmid #11179); Vector Backbone:pCAG-CFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30742127
Proper citation: RRID:Addgene_107941 Copy
Species: Acidaminococcus sp. BV3L6
Genetic Insert: human codon optimized DNase-inactive (D908A) enAsCas12a (E174R/S542R/K548R) fused to VPR activation domain
Vector Backbone Description: Backbone Marker:Connie Cepko lab (Addgene plasmid #11179); Vector Backbone:pCAG-CFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30742127
Proper citation: RRID:Addgene_107943 Copy
Species: Mus musculus
Genetic Insert: Egr2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5427; Vector Backbone:pcDNA3.1(-); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25535333
Comments: A Sal I site was introduced before the HindIII site to further transfer to pBabe.
Proper citation: RRID:Addgene_107997 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: gRNA-CAN1.Y, gRNA-ADE2.Y
Vector Backbone Description: Backbone Marker:George Church (Addgene plasmid # 43803); Backbone Size:5660; Vector Backbone:p426-SNR52p-gRNA.CAN1.Y-SUP4t; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25743786
Proper citation: RRID:Addgene_107929 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: gRNA-CAN1.Y, gRNA-ADE2.Y
Vector Backbone Description: Backbone Marker:George Church (Addgene plasmid # 43803); Backbone Size:5817; Vector Backbone:p426-SNR52p-gRNA.CAN1.Y-SUP4t; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25743786
Proper citation: RRID:Addgene_107927 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: gRNA-CAN1.Y, gRNA-ADE2.Y
Vector Backbone Description: Backbone Marker:George Church (Addgene plasmid # 43803); Backbone Size:5577; Vector Backbone:p426-SNR52p-gRNA.CAN1.Y-SUP4t; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25743786
Proper citation: RRID:Addgene_107924 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: gRNA-CAN1.Y
Vector Backbone Description: Backbone Marker:George Church (Addgene plasmid # 43803); Backbone Size:5593; Vector Backbone:p426-SNR52p-gRNA.CAN1.Y-SUP4t; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25743786
Proper citation: RRID:Addgene_107923 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: gRNA-CAN1.Y
Vector Backbone Description: Backbone Marker:George Church (Addgene plasmid # 43803); Backbone Size:5775; Vector Backbone:p426-SNR52p-gRNA.CAN1.Y-SUP4t; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25743786
Proper citation: RRID:Addgene_107922 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.