Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pET28-At_PRORP1-His Resource Report Resource Website |
RRID:Addgene_67869 | PRORP1 | Arabidopsis thaliana | Kanamycin | PMID:22976545 | The mitochondrial targeting sequence “MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPRF“ of native precursor PRORP1 was replaced with the dipeptide “MG” | Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Residues 36-572 (see comments) | 2026-08-15 01:18:39 | 0 |
|
pMAL-PIAL2M-wt Resource Report Resource Website |
RRID:Addgene_67909 | PIAL2 | Arabidopsis thaliana | Ampicillin | PMID:25415977 | Backbone Marker:NEB; Backbone Size:6700; Vector Backbone:pMAL-c2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | E281-A496 | 2026-08-15 01:18:43 | 0 | |
|
pABD823 Resource Report Resource Website |
RRID:Addgene_67911 | Cold temperature germinating 10 (CTG10) | Arabidopsis thaliana | Chloramphenicol | PMID:29632208 | Backbone Marker:Stratagene; Backbone Size:6494; Vector Backbone:pBD-GAL4 Cam; Vector Types:Yeast Expression; Bacterial Resistance:Chloramphenicol | 2026-08-15 01:18:39 | 0 | ||
|
pET28-At_PRORP2-His Resource Report Resource Website |
RRID:Addgene_67870 | PRORP2 | Arabidopsis thaliana | Kanamycin | PMID:22976545 | Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:18:39 | 0 | ||
|
pICSL11062 Resource Report Resource Website |
RRID:Addgene_68256 | Promoter_AtU6-26 + sgRNA_BolC.GA4a-2 | Arabidopsis thaliana | Ampicillin | PMID:26616834 | Target sequence: GTTGAGAGGGGAGCCGGTGA | Vector Backbone:pICH47761 (AddGene #48003); Vector Types:Plant Expression, Synthetic Biology; Bacterial Resistance:Ampicillin | 2026-08-15 01:18:41 | 0 | |
|
pICSL90002 Resource Report Resource Website 1+ mentions |
RRID:Addgene_68261 | Promoter: U6-26 (Arabidopsis thaliana) | Arabidopsis thaliana | Spectinomycin | PMID:26616834 | Vector Backbone:pAGM9121; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin | 2026-08-15 01:18:42 | 6 | ||
|
pPAt2S3 (GB0029) Resource Report Resource Website |
RRID:Addgene_68162 | At2S3 promoter | Arabidopsis thaliana | Ampicillin | PMID:23669743 | insert can be released with BsaI | Backbone Marker:self-made; derived from pGEMT-Easy manufactured by Promega; Vector Backbone:pUPD; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin | BsaI and BsmBI sites removed | 2026-08-15 01:18:41 | 0 |
|
pPAtUbq10 (GB0223) Resource Report Resource Website 1+ mentions |
RRID:Addgene_68174 | AtUbq10 promoter | Arabidopsis thaliana | Ampicillin | PMID:23669743 | insert can be released with BsaI | Backbone Marker:self-made; derived from pGEMT-Easy manufactured by Promega; Vector Backbone:pUPD; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin | BsaI and BsmBI sites removed | 2026-08-15 01:18:41 | 1 |
|
pHsp70B (GB0155) Resource Report Resource Website |
RRID:Addgene_68172 | AtHsp70B promoter | Arabidopsis thaliana | Ampicillin | PMID:23669743 | insert can be released with BsaI | Backbone Marker:self-made; derived from pGEMT-Easy manufactured by Promega; Vector Backbone:pUPD; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin | BsaI and BsmBI sites removed | 2026-08-15 01:18:45 | 0 |
|
pHsp18.2 (GB0153) Resource Report Resource Website |
RRID:Addgene_68171 | AtHsp18.2 promoter | Arabidopsis thaliana | Ampicillin | PMID:23669743 | insert can be released with BsaI | Backbone Marker:self-made; derived from pGEMT-Easy manufactured by Promega; Vector Backbone:pUPD; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin | BsaI and BsmBI sites removed | 2026-08-15 01:18:41 | 0 |
|
pOPTXcGMPRELUC Resource Report Resource Website 1+ mentions |
RRID:Addgene_68503 | OPTX promoter with cGMPRE | Arabidopsis thaliana | Kanamycin | PMID:24206622 | Backbone Marker:Calderon-Villalobos et al 2006 Plant Physiol 141:3-14 (GenBank: AY968054.1); Backbone Size:7272; Vector Backbone:pLUC Trap3 (GW); Vector Types:Bacterial Expression, Plant Expression; Bacterial Resistance:Kanamycin | 3x cGMPRE inserted 190bp 5' of ATG (cGMPRE = aaatagatttcaacagtt) | 2026-08-15 01:18:44 | 1 | |
|
pOPTXGARE Resource Report Resource Website |
RRID:Addgene_68542 | OPTX promoter with GARE | Arabidopsis thaliana | Kanamycin | PMID:24206622 | linker sequence between inserted GARE is 5' gagagcc 3' | Backbone Marker:Calderon-Villalobos et al 2006 Plant Physiol 141:3-14 (GenBank: AY968054.1); Backbone Size:7272; Vector Backbone:pLUC Trap3 (GW); Vector Types:Bacterial Expression, Plant Expression; Bacterial Resistance:Kanamycin | 5x GARE inserted 190 bp 5' pf ATG (GARE = taacaaa) | 2026-08-15 01:18:44 | 0 |
|
pDBTrp-LexABD-CRY2FL Resource Report Resource Website |
RRID:Addgene_78210 | LexABD-CRY2 | Arabidopsis thaliana | Kanamycin | PMID:25350266 | Backbone Marker:custom ; Vector Backbone:pDBTrp; Vector Types:Yeast Expression; Bacterial Resistance:Kanamycin | contains endogenous CRY2 NLS | 2026-08-15 01:20:22 | 0 | |
|
pSpal2At Resource Report Resource Website 1+ mentions |
RRID:Addgene_78286 | PAL2 | Arabidopsis thaliana | Chloramphenicol | PMID:21722749 | *Note: Addgene's quality control sequencing finds an E50A amino acid residue substitution in the A. thaliana PAL2 gene insert. The depositing laboratory does not believe this residue change will affect protein function. This plasmid accurately reflects the construct as it was used in the associated publication. | Backbone Size:2999; Vector Backbone:pSTV28; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol | *see below | 2026-08-15 01:20:23 | 2 |
|
INCTbiosyn-p35S-GFP(rc)4 Resource Report Resource Website 1+ mentions |
RRID:Addgene_127522 | EGFP reverse complement coding sequence flanked by attB/attP Integrase 4 attachment sites. | Arabidopsis thaliana | Ampicillin | PMID:32444777 | The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase 4 attachment sites sequences from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991). | Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:04:37 | 1 | |
|
INCTbiosyn-p35S-GFP(rc)2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_127521 | EGFP reverse complement coding sequence flanked by attB/attP Integrase 2 attachment sites. | Arabidopsis thaliana | Ampicillin | PMID:32444777 | The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase 2 attachment sites sequences from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991). | Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:04:37 | 1 | |
|
INCTbiosyn-p35S(rc)2_4_5-GFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_127520 | CaMV 35S reverse complement promoter sequence flanked by attB/attP Integrase 2, 4 and 5 attachment sites. | Arabidopsis thaliana | Ampicillin | PMID:32444777 | The CaMV 35S promoter in a reverse complement sequence orientation came from iGEM registry (BBa_K1547006 ) and the attB/P integrases 2, 4 and 5 attatchment sites flanking this sequence came from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014). This cassete was previously synthesized in pBluescript II SK(-) and after cloned using HindIII and BamHI replacing the forward CaMV 35S promoter sequence from a 35S-GFP plasmid construction of Chiu, W. et al. Curr. Biol. 6, 325-330 (1996). | Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:04:36 | 1 | |
|
INCTbiosyn-p35S-GFP(rc)7 Resource Report Resource Website 1+ mentions |
RRID:Addgene_127524 | EGFP reverse complement coding sequence flanked by attB/attP Integrase 7 attachment sites. | Arabidopsis thaliana | Ampicillin | PMID:32444777 | The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase 7 attachment sites sequences from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991). | Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:04:37 | 1 | |
|
INCTbiosyn-p35S-GFP(rc)Bxb1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_127528 | EGFP reverse complement coding sequence flanked by attB/attP Integrase Bxb1 attachment sites. | Arabidopsis thaliana | Ampicillin | PMID:32444777 | The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase Bxb1 attachment sites sequences from Bonnet, J. et al. Science 340, 599-603 (2013) (Genbank KC529327.1); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991). | Vector Backbone:pBluescript SK(-); Vector Types:Plant Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:04:37 | 1 | |
|
pEf1a OsTIR ires NEO pA T2BH Resource Report Resource Website 1+ mentions |
RRID:Addgene_127910 | OsTIR | Arabidopsis thaliana | Ampicillin | PMID:34106828 | Vector Backbone:pBSK; Vector Types:Transposon; Bacterial Resistance:Ampicillin | 2026-08-15 01:04:41 | 1 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
