Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 20 showing 381 ~ 400 out of 620 results
Snippet view Table view Download 620 Result(s)
Click the to add this resource to a Collection

http://www.addgene.org/170188

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 S (spike) B.1.1.7
Vector Backbone Description: Vector Backbone:pDest-303; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32504802
Comments: DNA sequence optimized for mammalian expression

Proper citation: RRID:Addgene_170188 Copy   


http://www.addgene.org/170204

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 N
Vector Backbone Description: Vector Backbone:pDest-527; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: DNA sequence optimized for E. coli expression

Proper citation: RRID:Addgene_170204 Copy   


http://www.addgene.org/170467

Species: SARS-CoV-2
Genetic Insert: Nucleocapsid
Vector Backbone Description: Vector Backbone:pHAGE; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Comments: Please visit https://www.biorxiv.org/content/10.1101/2021.09.10.459410v2 for bioRxiv preprint.

Proper citation: RRID:Addgene_170467 Copy   


http://www.addgene.org/161794

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 secretable trimeric Spike
Vector Backbone Description: Backbone Marker:Eric Kowarz; Backbone Size:6625; Vector Backbone:pSBbi-RP (Addgene Plasmid #60513); Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36619904
Comments: The SARS-CoV-2 secretable trimeric Spike insert was designed by Jorge L. Arias-Arias from Universidad de Costa Rica ([email protected]). This vector is suitable for transient transfection, but it was intended to be co-transfected with the transposase vector pCMV(CAT)T7-SB100 (Addgene Plasmid #34879) in order to generate stable mammalian cells for the production of SARS-CoV-2 secretable trimeric Spike protein. This protein can be recovered from the cell culture medium by His-tag purification. Please note that this plasmid is intended to be used as a DNA template of the spike gene but not as a construct for protein production. The protein produced using this plasmid is not antigenically functional.

Proper citation: RRID:Addgene_161794 Copy   


http://www.addgene.org/162819

Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF10
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)GYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT

Proper citation: RRID:Addgene_162819 Copy   


http://www.addgene.org/162818

Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF7b
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)IELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA - UniProtKB - P0DTD8 (NS7B_SARS2)

Proper citation: RRID:Addgene_162818 Copy   


http://www.addgene.org/162815

Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_M
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)ADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ - UniProtKB - P0DTC5 (VME1_SARS2)

Proper citation: RRID:Addgene_162815 Copy   


http://www.addgene.org/162820

Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF9c/14
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)LQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD

Proper citation: RRID:Addgene_162820 Copy   


http://www.addgene.org/162822

Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF3b(CoV1h)
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: SARS1-CoV homolog ORF3b with premature stop codon as described in Konno et. al., 2020 (doi:10.1016/j.celrep.2020.108185) - Protein sequence: (TAG)PTIFFAGILIVTTIVYLTIV

Proper citation: RRID:Addgene_162822 Copy   


  • RRID:Addgene_167263

http://www.addgene.org/167263

Species: SARS-CoV-2
Genetic Insert: Nsp3 (residues 1844-1945)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_167263 Copy   


  • RRID:Addgene_167262

http://www.addgene.org/167262

Species: SARS-CoV-2
Genetic Insert: Nsp3 (residues 1619-1945)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_167262 Copy   


  • RRID:Addgene_167257

http://www.addgene.org/167257

Species: SARS-CoV-2
Genetic Insert: Nsp3 (residues 1-111)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_167257 Copy   


  • RRID:Addgene_167259

http://www.addgene.org/167259

Species: SARS-CoV-2
Genetic Insert: Nsp3 (residues 1050-1216)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_167259 Copy   


http://www.addgene.org/167851

Species: SARS-CoV-2
Genetic Insert: nsp10
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33423577
Comments: SGC clone sample ID: nsp10_SARS2:MVC019-B04:C245486

Proper citation: RRID:Addgene_167851 Copy   


http://www.addgene.org/167850

Species: SARS-CoV-2
Genetic Insert: nsp16
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33423577
Comments: SGC clone sample ID: nsp16_SARS2:MVC019-B03:C245485

Proper citation: RRID:Addgene_167850 Copy   


http://www.addgene.org/167848

Species: SARS-CoV-2
Genetic Insert: nsp10, nsp16
Vector Backbone Description: Backbone Marker:SGC Toronto; Vector Backbone:p28BIOHTEV-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33423577
Comments: SGC clone sample ID: nsp16_SARS2-nsp10_SARS-MVC019-A11:C245481

Proper citation: RRID:Addgene_167848 Copy   


http://www.addgene.org/167847

Species: SARS-CoV-2
Genetic Insert: nsp10
Vector Backbone Description: Backbone Marker:SGC Toronto; Vector Backbone:p28BIOHTEV-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33423577
Comments: SGC clone sample ID: nsp10_SARS2:MVC019-A04:C245474

Proper citation: RRID:Addgene_167847 Copy   


http://www.addgene.org/167846

Species: SARS-CoV-2
Genetic Insert: nsp16
Vector Backbone Description: Backbone Marker:SGC Toronto; Vector Backbone:p28BIOHTEV-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33423577
Comments: SGC clone sample ID: nsp16_SARS2:MVC019-A03:C245473

Proper citation: RRID:Addgene_167846 Copy   


http://www.addgene.org/168777

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 RBD
Vector Backbone Description: Backbone Marker:Tim Whitehead (Addgene #168778); Vector Backbone:pJS697; Vector Types:Yeast Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34416153

Proper citation: RRID:Addgene_168777 Copy   


http://www.addgene.org/168776

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 RBD
Vector Backbone Description: Backbone Marker:Tim Whitehead (Addgene #168778); Vector Backbone:pJS697; Vector Types:Yeast Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34416153

Proper citation: RRID:Addgene_168776 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X