Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pFM052 Resource Report Resource Website |
RRID:Addgene_40146 | par-2 RNAi resistant (C56S) | Caenorhabditis elegans | Ampicillin | PMID:21983565 | Alternate plasmid name: pID3.01-par-2RR C56S | Backbone Marker:Addgene plasmid 22720; Backbone Size:18033; Vector Backbone:pID3.01; Vector Types:Worm Expression, Gateway Cloning; Bacterial Resistance:Ampicillin | C56S; base pairs 6-523 of par-2 were recoded to create the RNAi-resistant par-2 transgene. | 2026-08-15 01:14:34 | 0 |
|
pFM038 Resource Report Resource Website |
RRID:Addgene_40141 | par-2 RNAi resistant (R183-5A + 7SA) | Caenorhabditis elegans | Ampicillin | PMID:21983565 | Alternate plasmid name: pID3.01-par-2RR R183-5A + 7SA 7SA mutations are: S190A, S197A, S241A, S265A, S295A, S301A, and S335A Note: A deletion of amino acid residues 502-523 near the C-terminus of the protein was discovered during the Addgene quality control process and is present in this plasmid. | Backbone Marker:Addgene plasmid 22720; Backbone Size:18033; Vector Backbone:pID3.01; Vector Types:Worm Expression, Gateway Cloning; Bacterial Resistance:Ampicillin | R183-5A + 7SA; base pairs 6-523 of par-2 were recoded to create the RNAi-resistant par-2 transgene. | 2026-08-15 01:14:33 | 0 |
|
pFM034 Resource Report Resource Website |
RRID:Addgene_40137 | par-2 RNAi resistant (wild-type) | Ampicillin | PMID:21983565 | Alternate plasmid name: pID3.01-par-2RR wild-type | Backbone Marker:Addgene plasmid 22720; Backbone Size:18033; Vector Backbone:pID3.01; Vector Types:Worm Expression, Gateway Cloning; Bacterial Resistance:Ampicillin | Base pairs 6-523 of par-2 were recoded to create the RNAi-resistant par-2 transgene. | 2026-08-15 01:14:33 | 0 | |
|
pCAG-T7-TALEN(Sangamo)-FokI-ELD-Destination Resource Report Resource Website 1+ mentions |
RRID:Addgene_40132 | Ampicillin | PMID:24747757 | For more information on Pelczar TALEN Add-On Plasmids please refer to: http://www.addgene.org/TALeffector/goldengate/add-ons/#pelczar Please note that plasmid #40132 is only functional in combination with plasmid #40131. | Backbone Marker:CLONTECH; Backbone Size:4814; Vector Backbone:pDIRECT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:33 | 1 | |||
|
pLMB51 Resource Report Resource Website 1+ mentions |
RRID:Addgene_40083 | gusA | E. coli | Tetracycline | PMID:22820336 | GenBank accession number JQ895026 Multiple-cloning site (MCS) of pLMB51: GATTACCTCA GTCTAGAGCT CGAGAAGCTT GGATCCATGG TACCCTACA | Vector Backbone:RP4; Vector Types:Bacterial Expression; Bacterial Resistance:Tetracycline | 2026-08-15 01:14:33 | 1 | |
|
pLenti6/V5-DEST-RINT1 Resource Report Resource Website |
RRID:Addgene_40124 | RINT1 | Homo sapiens | Ampicillin | PMID:23074196 | Backbone Marker:Invitrogen; Backbone Size:7732; Vector Backbone:pLenti6-V5/DEST; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | L270M relative to NM_021930 | 2026-08-15 01:14:33 | 0 | |
|
pEG634 Resource Report Resource Website |
RRID:Addgene_40121 | Mex-5 (aa244-468) | Caenorhabditis elegans | Ampicillin | PMID:21925318 | Dendra::MEX-5 constructs were constructed as follows. A 4.4 kb mex-5 promoter fragment based on Tenlen et al. (2008) was cloned into pDONRP4P1R (Invitrogen). Dendra2/TEV/S-peptide (Gallo et al., 2010) was cloned into pDONR201. A MEX-5 genomic fragment from the start ATG through 648 bp of 3'UTR was cloned into pDONRP2RP3. Exon 2 of mex-5 was recoded to be RNAi-resistant (Gen-Script) so as to allow depletion of endogenous MEX-5/6 without depletion of the transgene. These constructs were assembled into pCG150 using three-way Gateway system (LR reaction) (Invitrogen) (Merritt et al., 2008). Mutations were made by recombinant PCR and all inserts were sequenced verified. Alternate plasmid name: pCG150 + 4.4kb+Dendra+ gen MEX-5 aa245-STOP (RNAi res) +3’UTR | Backbone Marker:Addgene plasmid 17247; Backbone Size:6351; Vector Backbone:pCG150; Vector Types:Worm Expression, Gateway Cloning; Bacterial Resistance:Ampicillin | contains aa244-468 | 2026-08-15 01:14:33 | 0 |
|
pEG628 Resource Report Resource Website |
RRID:Addgene_40120 | Mex-5 (aa1-244) (RNAi resistant) | Caenorhabditis elegans | Ampicillin | PMID:21925318 | Dendra::MEX-5 constructs were constructed as follows. A 4.4 kb mex-5 promoter fragment based on Tenlen et al. (2008) was cloned into pDONRP4P1R (Invitrogen). Dendra2/TEV/S-peptide (Gallo et al., 2010) was cloned into pDONR201. A MEX-5 genomic fragment from the start ATG through 648 bp of 3'UTR was cloned into pDONRP2RP3. Exon 2 of mex-5 was recoded to be RNAi-resistant (Gen-Script) so as to allow depletion of endogenous MEX-5/6 without depletion of the transgene. These constructs were assembled into pCG150 using three-way Gateway system (LR reaction) (Invitrogen) (Merritt et al., 2008). Mutations were made by recombinant PCR and all inserts were sequenced verified. Alternate plasmid name: pCG150 + 4.4kb+Dendra+ gen MEX-5 aa1-245 (RNAi res) +3’UTR | Backbone Marker:Addgene plasmid 17247; Backbone Size:6351; Vector Backbone:pCG150; Vector Types:Worm Expression, Gateway Cloning; Bacterial Resistance:Ampicillin | contains aa1-244, Exon 2 recoded to be RNAi-resistant | 2026-08-15 01:14:33 | 0 |
|
pEG408 Resource Report Resource Website |
RRID:Addgene_40086 | Mex-5 (aa 345 - 468) | Caenorhabditis elegans | Ampicillin | PMID:21925318 | MEX-5 transgenes driven by the pie-1 promoter and pie-1 3'UTR were constructed by cloning the mex-5 cDNA as a SpeI fragment downstream of a Dendra2/TEV/S-peptide tag cloned into pIC26 LAP tag (Cheeseman et al., 2004). Alternate plasmid name: pIC26 Dendra + MEX-5 (aa345-STOP) (Dendra + MEX-5 ORF) | Backbone Marker:Cheeseman lab; Backbone Size:16397; Vector Backbone:pIC26; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin | contains aa 345 - 468 | 2026-08-15 01:14:33 | 0 |
|
pLMB509 Resource Report Resource Website |
RRID:Addgene_40084 | gfpmut 3.1 | jellyfish | Gentamicin | PMID:22820336 | GenBank accession number: JQ895027 pLMB509 contains GFPmut3.1 reporter gene downstream of the inducible promoter tauAp and a ribosomal binding site (RBS), followed by a six-His tag and a transcriptional stop codon. NdeI restriction sites flank the reporter gene, enabling the easy removal of gfpmut3.1 and subsequent replacement with the desired gene in frame. This plasmid is compatible with BD In-Fusion cloning (Clontech) for the cloning of genes containing NdeI restriction sites | Backbone Size:4768; Vector Backbone:pBBRMCS5; Vector Types:Bacterial Expression; Bacterial Resistance:Gentamicin | 2026-08-15 01:14:33 | 0 | |
|
pAM1518 Resource Report Resource Website |
RRID:Addgene_40238 | psbAI promoter, luxCDE | Synechococcus elongatus PCC 7942 | Spectinomycin | PMID:10812624 | NS1 vector Lux Genes: luxCDE Directs luciferase substrate synthesis in PCC7942. psbAI promoter fragment from pAM1469 (NotI-BglII fragment) was cloned in pAM1504 cut with NotI-BamHI, upstream luxCDE. This plasmid directs aldehyde biosynthesis in cyanobacteria. | Vector Backbone:pAM1504; Vector Types:Cyanobacteria cloning vector; Bacterial Resistance:Spectinomycin | 2026-08-15 01:14:34 | 0 | |
|
pAM1414 Resource Report Resource Website |
RRID:Addgene_40237 | promoterless luxAB reporter | Synechococcus elongatus PCC 7942 | Spectinomycin | PMID:10812624 | NS1 vector Lux Genes: luxAB cloning sites NotI and BamHI Blunted (by Klenow) SalI-PvuII luxAB fragment (from pLAV1) was cloned in the SmaI site of pAM1303. SalI site is approximately 135bp upstream of luxA ATG within the luxD reading frame. You can clone promoters upstream of luxAB in NotI or BamHI sites. | Vector Backbone:pAM1303; Vector Types:Cyanobacteria cloning vector; Bacterial Resistance:Spectinomycin | 2026-08-15 01:14:34 | 0 | |
|
pET21b-LOV-ipaA Resource Report Resource Website 1+ mentions |
RRID:Addgene_40236 | LOV-ipaA | Synthetic | Ampicillin | PMID:22520757 | This vector encodes a photo-activable caged form of the vinculin binding ipaA peptide. Regarding the hybridized region, the first ten residues of the ipaA VBS1 helical peptide were identified as a close match to the last ten residues of the AsLOV2 Jα helix; five of the ten positions are identical, and the hydrophobic residues on the Jα helix that make critical contacts with the AsLOV2 domain beta-sheet at residues 539, 542, and 543 are conserved in the alignment with ipaA. Additionally, residues in the ipaA sequence that make extensive contacts with vinculin are conserved in the alignment (Ile 612, Ala 615, Ala 616, and Val 619 in ipaA). Side-chain optimization simulations were used to thread the first ten residues of ipaA onto the last ten residues of the Jα helix. The 540 position on the Jα helix was converted to isoleucine. The LOV-ipaA gene was synthesized with a six histidine N-terminal tag (Genscript, Piscataway, NJ, USA) and cloned into the pET21b vector. Protein coding sequence of LOV-ipaA: MHHHHHHGSLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTANNIIKAAKDVTTSLSKVLKNIN | Backbone Marker:EMD Biosciences; Backbone Size:5442; Vector Backbone:pET-21b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Jα helix region hybridized (AsLOV2 aa 537-546/ipaA aa 610-619), residue 540 changed to isoleucine | 2026-08-15 01:14:34 | 1 |
|
pRS413-GAL1-yEGFP1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_40235 | yEGFP1 | Ampicillin | yEGFP contains a M233I point mutation. Depositor states that this mutation does not affect yEGFP function. | Backbone Size:5667; Vector Backbone:pRS413; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:34 | 3 | |||
|
CD40L-MIEG-hCD4 (hCD4-CD40L) Resource Report Resource Website 1+ mentions |
RRID:Addgene_40355 | CD40L | Mus musculus | Ampicillin | PMID:19405121 | The CD40-ligand (CD40L)-expressing retroviral vector was constructed by PCR amplification of cDNA from anti-CD3 activated mouse T cells with the following primers for CD40-ligand: sense 5'-CTTTCAGTCAGCATGATAGAAACA-3' and antisense 5'-TCAGAGTTTGAGTAAGCCAAAAGA-3'; these primers were used to amplify the complete coding region of mouse CD40 ligand. The CD40-ligand gene was then reamplified with primers containing XhoI and NotI sites and then cloned via XhoI and NotI sites into a retroviral vector expressing human CD4. | Backbone Marker:Addgene plasmid 40569; Vector Backbone:MIEG-hCD4; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 2 | |
|
pMIEG3-JunDN Resource Report Resource Website 1+ mentions |
RRID:Addgene_40350 | Jun dominant negative | Homo sapiens | Ampicillin | PMID:15699140 | The Jun dominant negative vector was made by first preparing a version of c-Jun with the first 122 aa deleted. This cDNA was amplified by PCR from human c-Jun with the following primers: sense, 5-AAAAAA-GAATTC-ATGACTAGCCAGAACACGCTGCCCAGCGTC-3; antisense, 5-AAAAAA-GAATTC-TCAGCTGGCATAGTCAGGCACGTCATAAGGATAGCTAAATGTTTGCAAC-3. The antisense primer adds a hemagglutinin tag to the C terminus of c-Jun. The PCR product was then cut with EcoRI and cloned into the retroviral vector pMIEG3. | Backbone Marker:David A. Williams (PMID: 10961859); Vector Backbone:pMIEG3; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | first 122 amino acids deleted | 2026-08-15 01:14:35 | 7 |
|
pCXN2-BCL6 (CXN-BCL6) Resource Report Resource Website 1+ mentions |
RRID:Addgene_40346 | BCL6 | Homo sapiens | Ampicillin | PMID:12165517 | CXN-BCL-6 was constructed by inserting the human BCL-6 cDNA from pBS-BCL-6 full length (FL) via SalI ends into the XhoI site in the pCXN2 expression vector. The pCXN2 (CXN) vector was obtained from Dr. K. Ozato (National Institute of Child Health and Human Development, National Institutes of Health, Bethesda, MD) and consists of the human BCL-6 cDNA driven by a hybrid β-actin-CMV promoter. | Backbone Marker:Niwa, Yamamura, and Miyazaki (PMID: 1660837); Backbone Size:5200; Vector Backbone:pCXN2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 3 | |
|
pCIneoFH human RASSF6 Resource Report Resource Website |
RRID:Addgene_40344 | RASSF6 | Homo sapiens | Ampicillin | PMID:19797269 | pCIneoFH vector has the sequence NheI-FLAG-His6-EcoRI-MluI-XbaI-SalI-SmaI-NotI. A digest with NheI and SalI will excise the insert with tags. | Backbone Marker:Promega; Vector Backbone:pCI-neo (modified); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 0 | |
|
RSVpGL3 (RSV promoter-luciferase in pGL3-basic) Resource Report Resource Website 1+ mentions |
RRID:Addgene_40343 | RSV promoter | Rous sarcoma virus (RSV) | Ampicillin | PMID:12165517 | The Rous sarcoma virus (RSV) promoter reporter was constructed by isolating the RSV promoter from pRc/RSV (Invitrogen) via BglII and HindIII sites and cloned into pGL3-basic by the same sites. | Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-basic; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 2 | |
|
3xAP1pGL3 (3xAP-1 in pGL3-basic) Resource Report Resource Website 50+ mentions |
RRID:Addgene_40342 | 3xAP-1 | Ampicillin | PMID:12165517 | The 3 AP-1 reporter contains three canonical AP-1 binding sites (TGACTCA) upstream of a minimal promoter fragment containing a TATA box in the luciferase reporter plasmid pGL3-basic. | Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-basic; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | Contains three canonical AP-1 binding sites (TGACTCA) upstream of a minimal promoter fragment containing a TATA box | 2026-08-15 01:14:35 | 54 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
