Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
AtCOPT2 upGFP Resource Report Resource Website |
RRID:Addgene_117901 | AtCOPT2 upGFP | Arabidopsis thaliana | Bleocin (Zeocin) | insert amino acid sequence: MDHDHMHDMPPPSPSSSSMSNHTTPHMMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIVIFLLAVIAEWLAHSPILRVSGSTNRAAGLAQTAVYTLKTGLSYLVMLAVMSFNAGVFIVAIAGYGVGFFLFGSTTFKKPSDDQKTAELLPPSSGCVCENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-08-15 01:02:59 | 0 | ||
|
AtCOPT2 uPIC Resource Report Resource Website |
RRID:Addgene_117900 | AtCOPT2 uPIC | Arabidopsis thaliana | Bleocin (Zeocin) | insert amino acid sequence: MDHDHMHDMPPPSPSSSSMSNHTTPHMMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIVIFLLAVIAEWLAHSPILRVSGSTNRAAGLAQTAVYTLKTGLSYLVMLAVMSFNAGVFIVAIAGYGVGFFLFGSTTFKKPSDDQKTAELLPPSSGCVCENLYQSHHHHHH | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-08-15 01:02:58 | 0 | ||
|
AtCOPT1 upGFP Resource Report Resource Website |
RRID:Addgene_117899 | AtCOPT1 upGFP | Arabidopsis thaliana | Bleocin (Zeocin) | insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-08-15 01:02:58 | 0 | ||
|
AtCOPT1 uPIC Resource Report Resource Website |
RRID:Addgene_117898 | AtCOPT1 uPIC | Arabidopsis thaliana | Bleocin (Zeocin) | insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSHHHHHH | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-08-15 01:02:58 | 0 | ||
|
pESC/CURT_fluoB Resource Report Resource Website |
RRID:Addgene_117997 | CURT_fluoB | Arabidopsis thaliana | Ampicillin | PMID:30884945 | Backbone Marker:Agilent Technologies; Backbone Size:6571; Vector Backbone:pESC-URA; Vector Types:Yeast Expression, Yeast/bacteria binary vector; Bacterial Resistance:Ampicillin | 2026-08-15 01:02:59 | 0 | ||
|
pBAD/CURT_fluoB Resource Report Resource Website |
RRID:Addgene_117999 | CURT_fluoB | Arabidopsis thaliana | Ampicillin | PMID:30884945 | Backbone Marker:Invitrogen; Backbone Size:3956; Vector Backbone:pBAD; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:02:59 | 0 | ||
|
pN_35S/CTP-mCitrine Resource Report Resource Website 1+ mentions |
RRID:Addgene_117989 | CTP-mCitrine | Arabidopsis thaliana | Spectinomycin | PMID:30884945 | mCitrine contains an L7E compared to the published mCitrine sequence that does not impact plasmid function. | Backbone Size:9204; Vector Backbone:pN_35S; Vector Types:Plant Expression, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin | 2026-08-15 01:02:59 | 1 | |
|
pTKan-p35S::Csy4-pNOS::cogGFP (C132, JBEI-15898) Resource Report Resource Website |
RRID:Addgene_110145 | Csy4 | Arabidopsis thaliana | Spectinomycin | PMID:28094975 | Vector Backbone:pTKan-GW-R1R2; Vector Types:Bacterial Expression, Plant Expression; Bacterial Resistance:Spectinomycin | 2026-08-15 01:01:37 | 0 | ||
|
pTKan-p35S::Csy4-pC4H::cogRFP (C90, JBEI-15908) Resource Report Resource Website |
RRID:Addgene_110143 | Csy4 | Arabidopsis thaliana | Spectinomycin | PMID:28094975 | Vector Backbone:pTKan-GW-R1R2; Vector Types:Bacterial Expression, Plant Expression, binary vector; Bacterial Resistance:Spectinomycin | 2026-08-15 01:01:37 | 0 | ||
|
INCTbiosyn-p35S-GFP(rc)4 Resource Report Resource Website 1+ mentions |
RRID:Addgene_127522 | EGFP reverse complement coding sequence flanked by attB/attP Integrase 4 attachment sites. | Arabidopsis thaliana | Ampicillin | PMID:32444777 | The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase 4 attachment sites sequences from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991). | Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:04:37 | 1 | |
|
INCTbiosyn-p35S-GFP(rc)2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_127521 | EGFP reverse complement coding sequence flanked by attB/attP Integrase 2 attachment sites. | Arabidopsis thaliana | Ampicillin | PMID:32444777 | The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase 2 attachment sites sequences from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991). | Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:04:37 | 1 | |
|
INCTbiosyn-p35S(rc)2_4_5-GFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_127520 | CaMV 35S reverse complement promoter sequence flanked by attB/attP Integrase 2, 4 and 5 attachment sites. | Arabidopsis thaliana | Ampicillin | PMID:32444777 | The CaMV 35S promoter in a reverse complement sequence orientation came from iGEM registry (BBa_K1547006 ) and the attB/P integrases 2, 4 and 5 attatchment sites flanking this sequence came from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014). This cassete was previously synthesized in pBluescript II SK(-) and after cloned using HindIII and BamHI replacing the forward CaMV 35S promoter sequence from a 35S-GFP plasmid construction of Chiu, W. et al. Curr. Biol. 6, 325-330 (1996). | Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:04:36 | 1 | |
|
INCTbiosyn-p35S-GFP(rc)7 Resource Report Resource Website 1+ mentions |
RRID:Addgene_127524 | EGFP reverse complement coding sequence flanked by attB/attP Integrase 7 attachment sites. | Arabidopsis thaliana | Ampicillin | PMID:32444777 | The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase 7 attachment sites sequences from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991). | Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:04:37 | 1 | |
|
INCTbiosyn-p35S-GFP(rc)Bxb1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_127528 | EGFP reverse complement coding sequence flanked by attB/attP Integrase Bxb1 attachment sites. | Arabidopsis thaliana | Ampicillin | PMID:32444777 | The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase Bxb1 attachment sites sequences from Bonnet, J. et al. Science 340, 599-603 (2013) (Genbank KC529327.1); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991). | Vector Backbone:pBluescript SK(-); Vector Types:Plant Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:04:37 | 1 | |
|
pFH6_new Resource Report Resource Website |
RRID:Addgene_105866 | U6-26p::sgRNA scaffold | Arabidopsis thaliana | Ampicillin | PMID:34541122 | The new version of pFH6 (pFH6_new) provides > 10 times higher mutation efficiencies than the original version. In combination with pUB-Cas9, homozygous knockout plants can be created in Arabidopsis in the T2 generation at efficiencies of 50-100%. For cloning procedure, please use the attached protocol which is derived from Hahn et al., 2017 ( http://www.bio-protocol.org/e2384 ). | Backbone Marker:Promega; Backbone Size:3017; Vector Backbone:pGEM T-easy; Vector Types:Plant Expression, CRISPR, Synthetic Biology, Subcloning; Bacterial Resistance:Ampicillin | 2026-08-15 01:00:56 | 0 | |
|
pSLQ2822 pPB: CAG-GID1-KRAB-IRES-Puro-WPRE PGK-GAI-tagBFP-SpdCas9-ABI Resource Report Resource Website |
RRID:Addgene_106895 | GAI-tagBFP-Sp dCas9-ABI | Arabidopsis thaliana | Ampicillin | PMID:27776111 | Backbone Marker:System Biosciences; Vector Backbone:PB; Vector Types:Mammalian Expression, CRISPR, Synthetic Biology, PiggyBac; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:04 | 0 | ||
|
pHW-CIBN-MP-HRW-CRY2olig-VHH(GFP) Resource Report Resource Website |
RRID:Addgene_126026 | CIBN-MP; CRY2 PHRolig-VHH(GFP) | Arabidopsis thaliana | Ampicillin | PMID:30759894 | Vector Backbone:pHW; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | CRY2 E490G | 2026-08-15 01:04:21 | 0 | |
|
pHW-CIBN-MP-HRW-CRY2-VHH(GFP) Resource Report Resource Website |
RRID:Addgene_126024 | CIBN-MP; CRY2 PHR-VHH(GFP) | Arabidopsis thaliana | Ampicillin | PMID:30759894 | Vector Backbone:pHW; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | WT | 2026-08-15 01:04:21 | 0 | |
|
ARF17 pBluescript Resource Report Resource Website |
RRID:Addgene_12068 | ARF17 | Arabidopsis thaliana | Ampicillin | PMID:15829600 | The genomic sequence of ARF17 (At1g77850), including 1.9 and 1.7 kb of putative 5' and 3' regulatory sequences, respectively, was cloned as an 6.6-kb EcoRI-SpeI fragment into pBluescript II SK+ (Stratagene, La Jolla, CA) from the BAC F28K19. See "sequence" for full insert sequence. | Backbone Marker:Stratagene; Backbone Size:3000; Vector Backbone:pBluescript II SK+; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:03:25 | 0 | |
|
5mCUC1 pGreenII0129 Resource Report Resource Website |
RRID:Addgene_12067 | CUC1 mutant | Arabidopsis thaliana | Kanamycin | PMID:15202996 | See "sequence" for full insert sequence. See article for cloning details. | Backbone Size:5000; Vector Backbone:pGreenII0129; Vector Types:plant transformation via Agrobacterium; Bacterial Resistance:Kanamycin | miR-resistant CUC1. Made by introducing five silent mutations within the miR164-complementarity domain of a CUC1 genomic clone. | 2026-08-15 01:03:27 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
