Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Rattus norvegicus
Genetic Insert: SypHluorin 4x
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:19217377
Proper citation: RRID:Addgene_37005 Copy
Species: Rattus norvegicus
Genetic Insert: Red Fluorescent Calcium binding Protein
Vector Backbone Description: Backbone Marker:Life Technologies (Invitrogen); Backbone Size:2753; Vector Backbone:pRSETA; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23459413
Comments: Gene was cloned using BaMHI and HindIII - But part of the vector backbone then becomes part of the protein (leader sequence containing histag) - using NdeI and HindIII will completely remove the open reading frame/gene.
Proper citation: RRID:Addgene_42874 Copy
Species: Rattus norvegicus
Genetic Insert: mEGFP(A206K)-paCaMKII(K42M)
Vector Backbone Description: Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495
Comments: Only tested in HeLa cells, but not in neurons.
Proper citation: RRID:Addgene_165440 Copy
Species: Rattus norvegicus
Genetic Insert: tdTomato-P2A-paCaMKII
Vector Backbone Description: Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495
Proper citation: RRID:Addgene_165431 Copy
Species: Rattus norvegicus
Genetic Insert: tdTomato-P2A-paCaMKII(T286A)
Vector Backbone Description: Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495
Proper citation: RRID:Addgene_165432 Copy
Species: Rattus norvegicus
Genetic Insert: FHS-paCaMKII(SD)
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495
Proper citation: RRID:Addgene_165430 Copy
Species: Rattus norvegicus
Genetic Insert: tdTomato-P2A-paCaMKII(K42M)
Vector Backbone Description: Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495
Proper citation: RRID:Addgene_165433 Copy
Species: Rattus norvegicus
Genetic Insert: mEGFP(A206K)-paCaMKII
Vector Backbone Description: Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495
Comments: Only tested in HeLa cells, but not in neurons.
Proper citation: RRID:Addgene_165438 Copy
Species: Rattus norvegicus
Genetic Insert: iGluSnFR extracellular domain fused to TARP gamma-8 via NETO2 TM domain
Vector Backbone Description: Backbone Size:3950; Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36622100
Comments: Chimera of iGluSnFR (Addgene plasmid # 41732), Neto2 and Gamma-8
pAAV backbone is based on Addgene plasmid # 61463
Please visit https://doi.org/10.1101/2021.01.21.427382 for bioRxiv preprint.
Proper citation: RRID:Addgene_165498 Copy
Species: Rattus norvegicus
Genetic Insert: Cb5 tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: "KITTVESNSSWWTNWVIPAISALVVALMYRLYMAED" amino acid targeting sequence, which we refer to as "Cb5", for endoplasmic reticulum targeting. "7aa" indicates the 7 amino acid flexible linker region between Venus and the Cb5 targeting signal.
Proper citation: RRID:Addgene_166764 Copy
Species: Rattus norvegicus
Genetic Insert: T alpha 1p
Vector Backbone Description: Backbone Size:0; Vector Backbone:na; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17721509
Proper citation: RRID:Addgene_17707 Copy
Species: Rattus norvegicus
Genetic Insert: anti-TrpV3 (Rattus norvegicus) recombinant mouse monoclonal antibody
Vector Backbone Description: Backbone Marker:Gavin Wright, Sanger; Yves Durocher, NRC; Backbone Size:5925; Vector Backbone:P1316-IgG2a; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30667360
Comments: This is a recombinant antibody derived from RRID: AB_2877493. Isotype: IgG2a. A portion of this plasmid was derived from a plasmid, pTT3, which was obtained from Yves Durocher, National Research Council of Canada- Biotechnology Research Institute.
Proper citation: RRID:Addgene_177501 Copy
Species: Rattus norvegicus
Genetic Insert: AZ1
Vector Backbone Description: Backbone Marker:Sigma; Backbone Size:4700; Vector Backbone:pFLAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15277517
Proper citation: RRID:Addgene_11183 Copy
Species: Rattus norvegicus
Genetic Insert: Luciferase coding region with Cysteine 258 mutated to selenocysteine (U) and wild-type PHGPx SECIS in the 3' UTR
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15229221
Proper citation: RRID:Addgene_112144 Copy
Species: Rattus norvegicus
Genetic Insert: Luciferase coding region with Cysteine 258 mutated to selenocysteine (U) and wild-type SELENOP 3'UTR
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25063811
Proper citation: RRID:Addgene_112147 Copy
Species: Rattus norvegicus
Genetic Insert: Luciferase coding region with wild type Cysteine 258 and wild-type PHGPx SECIS in the 3' UTR
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15229221
Proper citation: RRID:Addgene_112146 Copy
Species: Rattus norvegicus
Genetic Insert: Glutamate receptor subunit
Vector Backbone Description: Backbone Marker:Life technologies; Backbone Size:4600; Vector Backbone:pCMV sport; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16765522
Proper citation: RRID:Addgene_112680 Copy
Species: Rattus norvegicus
Genetic Insert: jGCaMP8f
Vector Backbone Description: Vector Backbone:AAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_176756 Copy
Species: Rattus norvegicus
Genetic Insert: jGCaMP8m
Vector Backbone Description: Vector Backbone:AAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_176751 Copy
Species: Rattus norvegicus
Genetic Insert: jGCaMP8f
Vector Backbone Description: Vector Backbone:AAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_176750 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
