Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: FKHR
Vector Backbone Description: Backbone Size:4968; Vector Backbone:pGEX4T3; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_10706 Copy
Species: Synthetic
Genetic Insert: SaCas9
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
Comments: YFP sgRNA for SaCas9
Proper citation: RRID:Addgene_107050 Copy
Genetic Insert: 5i3eX
Vector Backbone Description: Vector Backbone:pUC; Vector Types:; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29932423
Proper citation: RRID:Addgene_106996 Copy
Genetic Insert: 3eX
Vector Backbone Description: Vector Backbone:pUC; Vector Types:; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29932423
Proper citation: RRID:Addgene_106993 Copy
Species: Synthetic
Genetic Insert: SaCas9
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
Comments: LacZ sgRNA for SaCas9
Proper citation: RRID:Addgene_107049 Copy
Genetic Insert: 5iX
Vector Backbone Description: Vector Backbone:pUC; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29932423
Proper citation: RRID:Addgene_106991 Copy
Species: Homo sapiens
Genetic Insert: Gamma adaptin 1
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5446; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: diagnostic digest with BamHI and EcoRI should release 2.1kb fragment.
Proper citation: RRID:Addgene_10712 Copy
Species: Homo sapiens
Genetic Insert: FKHRL1 AAA
Vector Backbone Description: Backbone Size:4000; Vector Backbone:pSG5L; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12150827
Proper citation: RRID:Addgene_10711 Copy
Genetic Insert: Xi3eX
Vector Backbone Description: Vector Backbone:pUC; Vector Types:; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29932423
Proper citation: RRID:Addgene_106998 Copy
Species: Caenorhabditis elegans
Genetic Insert: GFP-PH
Vector Backbone Description: Vector Backbone:pCFJ151; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28811311
Proper citation: RRID:Addgene_107020 Copy
Species: Caenorhabditis elegans
Genetic Insert: GFP-PH
Vector Backbone Description: Vector Backbone:pCFJ151; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28811311
Proper citation: RRID:Addgene_107016 Copy
Species: Caenorhabditis elegans
Genetic Insert: GFP-PH
Vector Backbone Description: Vector Backbone:pCFJ151; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28811311
Proper citation: RRID:Addgene_107013 Copy
Species: Caenorhabditis elegans
Genetic Insert: GFP-PH
Vector Backbone Description: Vector Backbone:pCFJ151; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28811311
Proper citation: RRID:Addgene_107019 Copy
Genetic Insert: SaCas9
Vector Backbone Description: Backbone Marker:derived from pX551 (Addgene#60957); Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_107032 Copy
Genetic Insert: SpCas9
Vector Backbone Description: Backbone Marker:derived from pX551 (Addgene#60957); Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_107031 Copy
Genetic Insert: GFP
Vector Backbone Description: Backbone Marker:derived from pX552 (Addgene# 60958); Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_107023 Copy
Species: Caenorhabditis elegans
Genetic Insert: GFP-PH
Vector Backbone Description: Vector Backbone:pCFJ151; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28811311
Proper citation: RRID:Addgene_107022 Copy
Species: Synthetic
Genetic Insert: colEdes12/Imdes12
Vector Backbone Description: Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30538236
Comments: Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes12: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFKKKFWKEVSKDPDLSKQFKGSNRENIKQGIAPFARQKDQVGGRRVFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes12: MELKHSISDYTEAEFLEFVKEICQKNSAGELDESLFKLVTEFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH
Proper citation: RRID:Addgene_107120 Copy
Species: Synthetic
Genetic Insert: M. sedula PCNA1 fused to CyPet
Vector Backbone Description: Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27228945
Proper citation: RRID:Addgene_107085 Copy
Species: Synthetic
Genetic Insert: S. solfataricus PCNA3 fused to YPet
Vector Backbone Description: Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27228945
Proper citation: RRID:Addgene_107084 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
