Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Saccharomyces cerevisiae
Genetic Insert: ACT1
Vector Backbone Description: Vector Backbone:pUC19; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments: for use in in vitro splicing reactions
Proper citation: RRID:Addgene_111326 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: ACT1
Vector Backbone Description: Vector Backbone:pUC19; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments: for use in in vitro splicing reactions
Proper citation: RRID:Addgene_111325 Copy
Species: Mus musculus
Genetic Insert: murine Syk (N)SH2 domain (Ser 8 to Gly 117), with an N-terminal (His)6 tag and TEV cleavage site
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
References:
Comments: encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTG
Proper citation: RRID:Addgene_111274 Copy
Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), with interdomain A (Phe 119 to His 162) substituted by a flexible 20aa linker
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
References:
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPGGSGGSGGSGSGGSGGSGGSEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ
Proper citation: RRID:Addgene_111272 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111311 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
References:
Comments: There is an additional mutation in snu114 E910G- Not sure if this affects plasmid function.
Proper citation: RRID:Addgene_111315 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111316 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111314 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
References:
Comments: A single myc epitope was placed immediately after the start codon of SNU114 by inserting the annealed oligos oKD140 (5′-AATTCCCAGAACAAAAATTGATTTCTGAAGAAGATTTGAATA-3′) and oKD141 (5′-GATCTATTCAAATCTTCTTCAGAAATCAATTTTTGTTCTGGG-3′), which have overhanging EcoRI/BglII sites, into the same sites of pTB4. The resulting plasmid was named pTB19.
Proper citation: RRID:Addgene_111317 Copy
Species: Homo sapiens
Genetic Insert: hH1-ARRET
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pENTR/D-hH1; Vector Types:Gateway Entry Cloning; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_111382 Copy
Species: Homo sapiens
Genetic Insert: TERRA
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pENTR/D-hH1; Vector Types:Gateway Entry Cloning; Bacterial Resistance:Kanamycin
References:
Comments: Depositing Scientist Sequence may not contain all correct information about the telomere sequence repeats such as canonical and variant repeat positions, and precise information about insert length. Further, the Addgene Partial NGS Result does not include the entire region of telomere repeats. Note that the BamHI site was destroyed during cloning.
Proper citation: RRID:Addgene_111383 Copy
Species: Synthetic
Genetic Insert: ChETA-mRuby2
Vector Backbone Description: Backbone Size:4116; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111389 Copy
Species: Synthetic
Genetic Insert: ChETA
Vector Backbone Description: Backbone Size:4836; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111386 Copy
Species: Mus musculus
Genetic Insert: mCAR
Vector Backbone Description: Backbone Size:4832; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111387 Copy
Species: Synthetic
Genetic Insert: CaCas9/sgRNA-BsmBI stuffer
Vector Backbone Description: Backbone Marker:Valmik Vyas; Vector Backbone:pV1025/pV1093; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Nourseothricin (clonNat)
References:
Comments:
Proper citation: RRID:Addgene_111429 Copy
Species: Synthetic
Genetic Insert: sgRNA-BsmBI stuffer
Vector Backbone Description: Backbone Marker:Valmik Vyas; Vector Backbone:pV1010; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111427 Copy
Species: Homo sapiens
Genetic Insert: ARRET w/o polyA
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pAd/PL-DEST; Vector Types:Adenoviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111374 Copy
Species: Homo sapiens
Genetic Insert: ARRET polyA
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pLenti6-UbC/V5-DEST; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111378 Copy
Species: Homo sapiens
Genetic Insert: TERRA polyA
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pLenti4/V5-DEST; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
References:
Comments: Please see the Addgene Partial NGS Result for the verified backbone. Please note this result contains only a part (around 670 bps) of the 800 bps telomere sequence repeats, with further variant repeats not seen by Sanger sequencing by the Depositor.
This plasmid may be prone to recombination due to the telomere hexanucleotide repeats, and therefore screening multiple colonies for the correct insert length is recommended before proceeding with downstream work
Proper citation: RRID:Addgene_111375 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: BRR2
Vector Backbone Description: Backbone Size:4967; Vector Backbone:pRS313; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
References:
Comments: Please note there is an additional mutation in brr2 T2015M- Unsure if this will affect plasmid function.
Proper citation: RRID:Addgene_111414 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.