Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: TRAF2
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pECFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_111201 Copy
Species: Homo sapiens
Genetic Insert: miR-E (miR-30 variant)
Vector Backbone Description: Vector Backbone:pQCXIX; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111169 Copy
Species: Homo sapiens
Genetic Insert: TRAF2
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_111202 Copy
Species: Homo sapiens
Genetic Insert: miR-E (miR-30 variant)
Vector Backbone Description: Vector Backbone:pQCXIX; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111166 Copy
Species: Homo sapiens
Genetic Insert: TRAF1
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEYFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_111200 Copy
Species: Homo sapiens
Genetic Insert: IKKalpha
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:Unknown; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_111206 Copy
Species: Homo sapiens
Genetic Insert: TRAF2
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEYFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_111203 Copy
Species: Homo sapiens
Genetic Insert: TNFRSF1A
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:Unknown; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_111209 Copy
Species: Mus musculus
Genetic Insert: TFPnls-T2a-Cre-Ert
Vector Backbone Description: Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111150 Copy
Species: Mus musculus
Genetic Insert: TFPnls-T2a-mErt-Cre-Ert
Vector Backbone Description: Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111151 Copy
Species: Xenopus laevis
Genetic Insert: TFPnls-T2a-mErt-Cre-Ert
Vector Backbone Description: Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111152 Copy
Species: Homo sapiens
Genetic Insert: hShh
Vector Backbone Description: Vector Backbone:pOEM1; Vector Types:Mammalian Expression, Insect Expression, Baculoviral rescue shuttle vector; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111156 Copy
Species: Ambystoma mexicanum
Genetic Insert: axFgf8
Vector Backbone Description: Vector Backbone:pOEM1; Vector Types:Mammalian Expression, Insect Expression, Baculoviral rescue shuttle vector; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111159 Copy
Species: Synthetic
Genetic Insert: DsRed-Express2
Vector Backbone Description: Backbone Marker:Herbert Schweizer; Vector Backbone:pUC18T-mini-Tn7T; Vector Types:Bacterial Expression; Bacterial Resistance:Gentamicin
References:
Comments: Please note that Addgene NGS results identified a 963T>A mutation in first FRT site compared to the depositing lab's sequence. The effect of this variant on FLP recombination efficiency is unknown.
Proper citation: RRID:Addgene_111260 Copy
Species: Homo sapiens
Genetic Insert: potassium voltage-gated channel subfamily KQT member 5 isoform 1 [Homo sapiens]
Vector Backbone Description: Backbone Marker:Novagen; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_111267 Copy
Species: Synthetic
Genetic Insert: PP7-mVenus
Vector Backbone Description: Vector Backbone:pNEB193; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111268 Copy
Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), the unphosphorylated form
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
References:
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ
Proper citation: RRID:Addgene_111269 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SUB2
Vector Backbone Description: Backbone Size:6018; Vector Backbone:pRS315; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111302 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: PRP5
Vector Backbone Description: Backbone Size:7950; Vector Backbone:yCP50; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
References:
Comments: Full plasmid sequence contains several ambiguous bases in the backbone- Unsure if these regions will affect function.
Proper citation: RRID:Addgene_111303 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4887; Vector Backbone:pRS316; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111308 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.